PRGDB00187971 (Fpr.15539)

From PRG Wiki
Jump to: navigation, search
Fpr.15539
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237604043 (GO881290)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Festuca pratensis

Comment?

CLS_CLiFpEfSpn_85a4_1_d16cLibkit5LD_B08 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 85d16 5', mRNA sequence

DNA Sequence

AGGCTCCCCTCTATAGATATGAGGACACTAATCACCGGTAGGTTTTTTCTCGCTCATATCTTCTTCAGCCGGTCGCTCCACTGCCACAGGGTTCGGTTGATCAAATCATTGGACATCTCCATAAACTGTTCCAGCTTGTGCTCTCTCGACCACCTGCAGGTTTCCCATAGGGCTCAGCCCAAGTCTCCAATAGGAGGACGAGGGAAACATGGAACGTGGCGTATTGGAGCGCATATTTGACGGAAGCATCGAACCAAGAGATGTAAAGTTATCAGCTCTAGAGAGCATCACTGAAAATTTCTCCGAAGAGCGAATAATTGGCCAGGGCGGATTTGGAACCGTTTACAAGGGTGTCCTAAAAAATGGAGAAGTTGCTGTGAAGAGGCTAAGGAACAACCATACAATAGATGAGAAGCTATTTCGCCGGGAGGTTAATAGTCTATTGAATGTAAACCATACGAATATTGTTCGGTTTCTTGGATTCTGTTCTAATACAGAACATAAAGCAATCAAATGTGAAGGATCAAACGAATACATCTATGCCGAGGATAGAGAAAGAATACTCTGTTTTGAGTACATCAACCACGGAAGTCTCGACAAATATATTGCAGATGAATTAAGAGGGCTTCAGTGGGACACTCGTTATCTCATAATAAAAGGGATATGCGATGGTCTGCAGTATCTTCATATGGAAAAGAATATTGTTCATATGGATTTGAAGCCGGCGAACATACTAATAGATCATAATATGGTAGCCAAAATAACTGACTTTGGTTTATCAAAGATGATGGAAAACTCACAAACCAAAAATTACTACCCCCTTTTTTTACAATAGGATACACCGCTCCAGAATACCTAGAAAATGGGAAAATGTCAGTCAAGTCTGATGTTTATAGCCTTGGCATCATATAATCGAACTAGTGACAGGACATAGGAGTATCCCCGATATTAAGAATGTACTTAGAAGGTGGAAGCACAGATTGCGTAAATCAGGAAAGAAACACGTTTAGATACCAGCAAATAACTAAACTCATCGAGATTGGGCCTACTC


Protein sequences

Name Description Sequence
Fpr.15539 translated coding region predicted by ESTScan from UniGene Fpr.15539

MERGVLERIFDGSIEPRDVKLSALESITENFSEERIIGQGGFGTVYKGVLKNGEVAVKRLRNNHTIDEKLFRREVNSLLNVNHTNIVRFLGFCSNTEHKAIKCEGSNEYIYAEDRERILCFEYINHGSLDKYIADELRGLQWDTRYLIIKGICDGLQYLHMEKNIVHMDLKPANILIDHNMVAKITDFXFIKDDGKLTNQKLLPPFFTIGYTAPEYLENGKMSVKSDVYSLGIIXSNXXQDIGVSPILRMYLEGGSTDCVNQERNTFRYQQITKLIEIGPTX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
3-234 Protein kinase-like (PK-like)
Protein kinase-like domain

RGVLERIFDGSIEPRDVKLSALESITENFSEERIIGQGGFGTVYKGVLKNGEVAVKRLRNNHTIDEKLFRREVNSLLNVNHTNIVRFLGFCSNTEHKAIKCEGSNEYIYAEDRERILCFEYINHGSLDKYIADELRGLQWDTRYLIIKGICDGLQYLHMEKNIVHMDLKPANILIDHNMVAKITDFXFIKDDGKLTNQKLLPPFFTIGYTAPEYLENGKMSVKSDVYSLGII

HMMPanther: PTHR24420
6-234 FAMILY NOT NAMED,FAMILY NOT NAMED

LERIFDGSIEPRDVKLSALESITENFSEERIIGQGGFGTVYKGVLKNGEVAVKRLRNNHTIDEKLFRREVNSLLNVNHTNIVRFLGFCSNTEHKAIKCEGSNEYIYAEDRERILCFEYINHGSLDKYIADELRGLQWDTRYLIIKGICDGLQYLHMEKNIVHMDLKPANILIDHNMVAKITDFXFIKDDGKLTNQKLLPPFFTIGYTAPEYLENGKMSVKSDVYSLGII

Gene3D: G3DSA:3.30.200.20
16-90 no description

PRDVKLSALESITENFSEERIIGQGGFGTVYKGVLKNGEVAVKRLRNNHTIDEKLFRREVNSLLNVNHTNIVRFL

ProfileScan: PS50011
IPR000719
31-282 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEERIIGQGGFGTVYKGVLKNGEVAVKRLRNNHTIDEKLFRREVNSLLNVNHTNIVRFLGFCSNTEHKAIKCEGSNEYIYAEDRERILCFEYINHGSLDKYIADELRGLQWDTRYLIIKGICDGLQYLHMEKNIVHMDLKPANILIDHNMVAKITDFXFIKDDGKLTNQKLLPPFFTIGYTAPEYLENGKMSVKSDVYSLGIIXSNXXQDIGVSPILRMYLEGGSTDCVNQERNTFRYQQITKLIEIGPTX

HMMSmart: SM00220
IPR002290
31-276 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSEERIIGQGGFGTVYKGVLKNGEVAVKRLRNNHTIDEKLFRREVNSLLNVNHTNIVRFLGFCSNTEHKAIKCEGSNEYIYAEDRERILCFEYINHGSLDKYIADELRGLQWDTRYLIIKGICDGLQYLHMEKNIVHMDLKPANILIDHNMVAKITDFXFIKDDGKLTNQKLLPPFFTIGYTAPEYLENGKMSVKSDVYSLGIIXSNXXQDIGVSPILRMYLEGGSTDCVNQERNTFRYQQITKLI

HMMSmart: SM00219
IPR020635
31-276 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSEERIIGQGGFGTVYKGVLKNGEVAVKRLRNNHTIDEKLFRREVNSLLNVNHTNIVRFLGFCSNTEHKAIKCEGSNEYIYAEDRERILCFEYINHGSLDKYIADELRGLQWDTRYLIIKGICDGLQYLHMEKNIVHMDLKPANILIDHNMVAKITDFXFIKDDGKLTNQKLLPPFFTIGYTAPEYLENGKMSVKSDVYSLGIIXSNXXQDIGVSPILRMYLEGGSTDCVNQERNTFRYQQITKLI

HMMPfam: PF00069
IPR000719
33-236 Pkinase,Ser-thr
Protein kinase, catalytic domain

EERIIGQGGFGTVYKGVLKNGEVAVKRLRNNHTIDEKLFRREVNSLLNVNHTNIVRFLGFCSNTEHKAIKCEGSNEYIYAEDRERILCFEYINHGSLDKYIADELRGLQWDTRYLIIKGICDGLQYLHMEKNIVHMDLKPANILIDHNMVAKITDFXFIKDDGKLTNQKLLPPFFTIGYTAPEYLENGKMSVKSDVYSLGIIXS

PatternScan: PS00107
IPR017441
37-58 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGQGGFGTVYKGVLKNGEVAVK

Gene3D: G3DSA:1.10.510.10
91-234 no description

GFCSNTEHKAIKCEGSNEYIYAEDRERILCFEYINHGSLDKYIADELRGLQWDTRYLIIKGICDGLQYLHMEKNIVHMDLKPANILIDHNMVAKITDFXFIKDDGKLTNQKLLPPFFTIGYTAPEYLENGKMSVKSDVYSLGII

PatternScan: PS00108
IPR008271
165-177 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHMDLKPANILI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox