PRGDB00187973 (Fpr.15334)

From PRG Wiki
Jump to: navigation, search
Fpr.15334
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237584996 (GO859082)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Festuca pratensis

Comment?

CLS_CLiFpEfSpn_34a1_1_m01cLibkit5LD_G01 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 34m01 5', mRNA sequence

DNA Sequence

CACATGAGGATTCTCTGCAAGGTTCAAAGGAGTTCTGCACAGAAATAGAGTTGTTATCCAGATTGCATCATCGGAATCTGGTTTCATTAGTTGGTTATTGCGATGAAGAAGATGAACAGATGCTAGTTTATGAGTTCATGCCAAACGGCACTTTACGCGATCATCTTTCTTCCAAGTCCAAACGATCTCCTGGCTTTGGTTTGAGGTTGCACATTGCATTGGGTGCTTCCAAGGGAATTCTGTATCTACACACTGATGCAAACCCTCCTATATTTCACCGTGATGTGAAGGCCAGTAACATTCTGTTGGACTCAAAATTTGTTGCAAAGGTGGCTGACTTTGGTCTTTCGAGGCTTGCTCCGGTGCCAGATATTGAAGGGACATTAGCAGGTCATGTTTCCACTGTTGTTAAAGGCACACCGGGGTATCTTGATCCAGAATACTTCCTGACTCATAAATTGACAGACAAGAGTGACGTGTATAGCCTTGGCGTTGTGTTTCTTGAAATTCTGACTGGGATGAAGCCAATTGAGCATGGGAAAAACATAGTGAGAGAGGTAAACAAAGCGTACCAATCAGGCGATATATCTGAAATCGTTGACAGCCGGATGGGCCTGTGTCCTCCAGACTGCATCAGCAGGTTCCTCTTGCTAGCAACCAAGTGCTGTCAGGACGAGACTGATGACAGACCTTCCATGTCAGAGATCGTCCGAGAACTCGAGGCCATCATGAGGATGATGCCCGAGGTGGATTTTGTTTTGCTGGAGACCATAGACACAGACTCGGCTGATATGACCAAATCCTTGTCAACTGCTTCAGCAACTGGAACTTCCTTTGTCTCACAGACTTCTGGCAGTGTCAATGCCAGCAGTGGCGTGCTCTCTGGGGTGCTGACTCCTCGATGATCTTGGTGTTTTCGTGGTGTTGTCACTTGTAAATGCAACGATGTTTTGTGGCCTCGACTTGTTACACTAGGATCATTTGTGTTGTAGTACTAATTAATTAGTCAGCTTTGATGTAAATATATAATGTGATGACACTGAGGATAGTGACATGAGCTATGATCTATCTTCAAAAAAAAAAAAAAAAAAA


Protein sequences

Name Description Sequence
Fpr.15334 translated coding region predicted by ESTScan from UniGene Fpr.15334

XHEDSLQGSKEFCTEIELLSRLHHRNLVSLVGYCDEEDEQMLVYEFMPNGTLRDHLSSKSKRSPGFGLRLHIALGASKGILYLHTDANPPIFHRDVKASNILLDSKFVAKVADFGLSRLAPVPDIEGTLAGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEILTGMKPIEHGKNIVREVNKAYQSGDISEIVDSRMGLCPPDCISRFLLLATKCCQDETDDRPSMSEIVRELEAIMRMMPEVDFVLLETIDTDSADMTKSLSTASATGTSFVSQTSGSVNASSGVLSGVLTPR

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-244 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XHEDSLQGSKEFCTEIELLSRLHHRNLVSLVGYCDEEDEQMLVYEFMPNGTLRDHLSSKSKRSPGFGLRLHIALGASKGILYLHTDANPPIFHRDVKASNILLDSKFVAKVADFGLSRLAPVPDIEGTLAGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEILTGMKPIEHGKNIVREVNKAYQSGDISEIVDSRMGLCPPDCISRFLLLATKCCQDETDDRPSMSEIVRELEAIM

HMMSmart: SM00220
IPR002290
1-247 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XHEDSLQGSKEFCTEIELLSRLHHRNLVSLVGYCDEEDEQMLVYEFMPNGTLRDHLSSKSKRSPGFGLRLHIALGASKGILYLHTDANPPIFHRDVKASNILLDSKFVAKVADFGLSRLAPVPDIEGTLAGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEILTGMKPIEHGKNIVREVNKAYQSGDISEIVDSRMGLCPPDCISRFLLLATKCCQDETDDRPSMSEIVRELEAIMRMM

HMMPanther: PTHR24420:SF772
2-249 SUBFAMILY NOT NAMED

HEDSLQGSKEFCTEIELLSRLHHRNLVSLVGYCDEEDEQMLVYEFMPNGTLRDHLSSKSKRSPGFGLRLHIALGASKGILYLHTDANPPIFHRDVKASNILLDSKFVAKVADFGLSRLAPVPDIEGTLAGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEILTGMKPIEHGKNIVREVNKAYQSGDISEIVDSRMGLCPPDCISRFLLLATKCCQDETDDRPSMSEIVRELEAIMRMMPE

HMMPanther: PTHR24420
2-249 FAMILY NOT NAMED,FAMILY NOT NAMED

HEDSLQGSKEFCTEIELLSRLHHRNLVSLVGYCDEEDEQMLVYEFMPNGTLRDHLSSKSKRSPGFGLRLHIALGASKGILYLHTDANPPIFHRDVKASNILLDSKFVAKVADFGLSRLAPVPDIEGTLAGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEILTGMKPIEHGKNIVREVNKAYQSGDISEIVDSRMGLCPPDCISRFLLLATKCCQDETDDRPSMSEIVRELEAIMRMMPE

HMMSmart: SM00219
IPR020635
2-240 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

HEDSLQGSKEFCTEIELLSRLHHRNLVSLVGYCDEEDEQMLVYEFMPNGTLRDHLSSKSKRSPGFGLRLHIALGASKGILYLHTDANPPIFHRDVKASNILLDSKFVAKVADFGLSRLAPVPDIEGTLAGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEILTGMKPIEHGKNIVREVNKAYQSGDISEIVDSRMGLCPPDCISRFLLLATKCCQDETDDRPSMSEIVREL

superfamily: SSF56112
IPR011009
5-263 Protein kinase-like (PK-like)
Protein kinase-like domain

SLQGSKEFCTEIELLSRLHHRNLVSLVGYCDEEDEQMLVYEFMPNGTLRDHLSSKSKRSPGFGLRLHIALGASKGILYLHTDANPPIFHRDVKASNILLDSKFVAKVADFGLSRLAPVPDIEGTLAGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEILTGMKPIEHGKNIVREVNKAYQSGDISEIVDSRMGLCPPDCISRFLLLATKCCQDETDDRPSMSEIVRELEAIMRMMPEVDFVLLETIDTDSA

Gene3D: G3DSA:3.30.200.20
5-49 no description

SLQGSKEFCTEIELLSRLHHRNLVSLVGYCDEEDEQMLVYEFMPN

HMMPfam: PF07714
IPR001245
7-240 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

QGSKEFCTEIELLSRLHHRNLVSLVGYCDEEDEQMLVYEFMPNGTLRDHLSSKSKRSPGFGLRLHIALGASKGILYLHTDANPPIFHRDVKASNILLDSKFVAKVADFGLSRLAPVPDIEGTLAGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEILTGMKPIEHGKNIVREVNKAYQSGDISEIVDSRMGLCPPDCISRFLLLATKCCQDETDDRPSMSEIVREL

Gene3D: G3DSA:1.10.510.10
50-249 no description

GTLRDHLSSKSKRSPGFGLRLHIALGASKGILYLHTDANPPIFHRDVKASNILLDSKFVAKVADFGLSRLAPVPDIEGTLAGHVSTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLEILTGMKPIEHGKNIVREVNKAYQSGDISEIVDSRMGLCPPDCISRFLLLATKCCQDETDDRPSMSEIVRELEAIMRMMPE

PatternScan: PS00108
IPR008271
91-103 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IFHRDVKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox