PRGDB00187974 (Fpr.15658)

From PRG Wiki
Jump to: navigation, search
Fpr.15658
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237594954 (GO868131)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Festuca pratensis

Comment?

CLS_CLiFpEfSpn_56a2_2_o04cLibkit5LD_H02 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 56o04 5', mRNA sequence

DNA Sequence

CACACCACAAGCAAGATCCAGAAGAAGAGAGGAGCCTACCGTGGAGTGGAGATGGCCGTAAGCATGATTCAGGAGTACGCCATACAGTTGATCATGGACGCCGGGGTGAACGCCCGCGAAGCGATCCAGCTGAACGACGAGATTTCCCGCCTCCGTACCATCTTGCCCAGAGCTCACCTCCTCATCGACCGCGCCGAGTGGGGTAGGCTGAAGAGCAGCGACTTTGCGACGCTGCTCTCTAAGCTCAAAGACACCACCTACGTCGCCGAGGACCTTCTCCGCGGGTTCGAGGACCAGCTGGCTCGACAGAAAATTGAGGACGAGGGCCGCGGCAGTGTAGGTCGAATCTTCTCTTCCTCTTTTAATCTTTTCAAGGTGTGGTTCAGAGGCATCAGGGGAAGGCTCACGGAGGCCCAAGAAAATCTCAGCAAGGTCATGGATGCAGTAGGAAGAGTTATTGCCTTGATGGGTCTTGATGTTCCAGGGGCGCAACAGCTGATGCCGGAGACTAGTCCAGTCCTGACGGGGCCAGTGTTCGGCCGTGATGAAGAAAGGGATGTTGCGATTGAGAAGCTGGGCGTCACGATTGGCCGCGAAGAGGCACGAGACTGGGCAATCCAGCAAATGGGTGTGCCACTCGTCGCCGGAGCCGGAGGTGGTGAATCTGCTCTTGGAAACGAGAGAGCGGCACAAGGCAGTGCTAAGCGCCTGAAAGGAGAGAGTAGCAGAGGTGCCGAGTTGACGGCCACCGGCAATCTTTCCGTCTTGCCCATTGTTGGCATTGGCGGGGTCGGGAAGACTACCTTGGCTCAATACACCTTCAATGATGCAAGGGTTGAGGAGCACTTTTCCTTGATGTTGTGGGTCTGTGTTTCTGATATTTTTGACAACAAAAGGATAACAAAGGAGATCCTGGAGTCCATCCCTAGAGATGGAAATCAACCTTTGAACTCTTTGGGAAGCTTAGGCGCTCTTCAAAAGGAATTCAAGATGCGGCTGCAGGGCAAAAATTTCTATTGGTGTTGGATGATGTGTGGGAGATTACAAAAATGAAATGGCAGACCTT


Protein sequences

Name Description Sequence
Fpr.15658 translated coding region predicted by ESTScan from UniGene Fpr.15658

HTTSKIQKKRGAYRGVEMAVSMIQEYAIQLIMDAGVNAREAIQLNDEISRLRTILPRAHLLIDRAEWGRLKSSDFATLLSKLKDTTYVAEDLLRGFEDQLARQKIEDEGRGSVGRIFSSSFNLFKVWFRGIRGRLTEAQENLSKVMDAVGRVIALMGLDVPGAQQLMPETSPVLTGPVFGRDEERDVAIEKLGVTIGREEARDWAIQQMGVPLVAGAGGGESALGNERAAQGSAKRLKGESSRGAELTATGNLSVLPIVGIGGVGKTTLAQYTFNDARVEEHFSLMLWVCVSDIFDNKRITKEILESIPRDGNQPXELFGKLRRSSKGIQDAAAGQKFLLVLDDVWEITKMKWQTX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF142
16-308 OS04G0312000 PROTEIN,OS04G0312000 PROTEIN

VEMAVSMIQEYAIQLIMDAGVNAREAIQLNDEISRLRTILPRAHLLIDRAEWGRLKSSDFATLLSKLKDTTYVAEDLLRGFEDQLARQKIEDEGRGSVGRIFSSSFNLFKVWFRGIRGRLTEAQENLSKVMDAVGRVIALMGLDVPGAQQLMPETSPVLTGPVFGRDEERDVAIEKLGVTIGREEARDWAIQQMGVPLVAGAGGGESALGNERAAQGSAKRLKGESSRGAELTATGNLSVLPIVGIGGVGKTTLAQYTFNDARVEEHFSLMLWVCVSDIFDNKRITKEILESI

HMMPanther: PTHR23155
16-308 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VEMAVSMIQEYAIQLIMDAGVNAREAIQLNDEISRLRTILPRAHLLIDRAEWGRLKSSDFATLLSKLKDTTYVAEDLLRGFEDQLARQKIEDEGRGSVGRIFSSSFNLFKVWFRGIRGRLTEAQENLSKVMDAVGRVIALMGLDVPGAQQLMPETSPVLTGPVFGRDEERDVAIEKLGVTIGREEARDWAIQQMGVPLVAGAGGGESALGNERAAQGSAKRLKGESSRGAELTATGNLSVLPIVGIGGVGKTTLAQYTFNDARVEEHFSLMLWVCVSDIFDNKRITKEILESI

HMMPfam: PF00931
IPR002182
250-353 NB-ARC,NBS
NB-ARC

TGNLSVLPIVGIGGVGKTTLAQYTFNDARVEEHFSLMLWVCVSDIFDNKRITKEILESIPRDGNQPXELFGKLRRSSKGIQDAAAGQKFLLVLDDVWEITKMKW

superfamily: SSF52540
251-348 P-loop containing nucleoside triphosphate hydrolases

GNLSVLPIVGIGGVGKTTLAQYTFNDARVEEHFSLMLWVCVSDIFDNKRITKEILESIPRDGNQPXELFGKLRRSSKGIQDAAAGQKFLLVLDDVWEI

FPrintScan: PR00364
IPR000767
255-270 DISEASERSIST
Disease resistance protein

VLPIVGIGGVGKTTLA

FPrintScan: PR00364
IPR000767
332-346 DISEASERSIST
Disease resistance protein

AAAGQKFLLVLDDVW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox