PRGDB00187975 (Fpr.14966)

From PRG Wiki
Jump to: navigation, search
Fpr.14966
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237600018 (GO876657)
Gene Class Unknown
Domain Type
Gene Species Festuca pratensis

Comment?

CLS_CLiFpEfSpn_72a2_1_a12cLibkit5LD_A06 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 72a12 5', mRNA sequence

DNA Sequence

AGCATTGGTGGGACTTCCAGGAGTGAATGGTTTATCCAAGAAAGCGGAAAAGGCTCACCATTGCTGTTGAACTTGTTGCCAACCCGTCCATCATATTCATGGACGAACCAACTTCTGGACTAGATGCAAGGGCAGCTGCAATTGTGATGAGGGCGGTCAGAAACACGGTTGACACAGGAAGAACAGTTGTCTGCACCATCCATCAGCCCAGCATTGACATCTTTGAAGCCTTTGATGAGCTATTTCTGATGAAACGGGGAGGTGAAGAAATATATGTTGGGCCCTTGGGACACAACTCATGCCATCTGATCAGTTACTTTGAGGGAATACAAGGAGTGAAGAAAATCAAGGATGGTTACAACCCTGCAACTTGGATGTTAGAAGTGACTACCCTAGCTCAAGAAGATGCCCTGGGGGTCAACTTCGCCGAAGTATACATGAATTCTGACCTATACCGGAGGAACAAAGCTTTGATAAGTGACCTAAGCACACCTCCTCCTGGATCGACGGACCTGTACTTCCCAAACCAGTACGCACAGTCCTTCTTCACACAATGTATTGCTTGCCTGTGGAAGCAGCACAAGTCATACTGGAGAAATCCGTCATACACTGCGACTAGAATATTCTTCACGATGGTTATTGCCCTCATCTTCGGCACCATCTTCTTGAACCTAGGCAAGAAAGTAGACAAGAGACAAGACCTGTTCAACTCTCTGGGTTCCATGTACGCAGCAGTCATTTTCATTGGAATTCAGAATGGCCAATGCGTTCAACCGATTGTAGACATAGAACGAACAGTCTTCTACCGAGAAAAAGCTGCCGGGATGTACTCTGCTCTACCCTATGCTTTTGCGCAGGTTTTCATTGAGATCCCACACGTTTTCCTCCAGACCCTTGTGTATGGTCTGATTGTCTACAGCTTGATTGGGTTTAGACTGGGTATTTATGAAATTCTTTTGGTACATGTTTTTCATGTTCTTCACTTCCTGTACTTCACATCTATGGCATGAATGGCAGTCGCCATGACAACAAACAGCGACATTGCTGCCATAGTTGCAACTGCATCTATGCAGTATGGGATTATCTTTGCTGGTTTCCTTGTCCCCGGACAA


Protein sequences

Name Description Sequence
Fpr.14966 translated coding region predicted by ESTScan from UniGene Fpr.14966

XALVGLPGVNGLSKKGKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGHNSCHLISYFEGIQGVKKIKDGYNPATWMLEVTTLAQEDALGVNFAEVYMNSDLYRRNKALISDLSTPPPGSTDLYFPNQYAQSFFTQCIACLWKQHKSYWRNPSYTATRIFFTMVIALIFGTIFLNLGKKVDKRQDLFNSLGSMYAAVIFIGIQNGQCVQPIVDIERTVFYREKAAGMYSALPYAFAQVFIEIPHVFLQTLVYGLIVYSLIGFRLGIYEILLVHVFHVLHFLYFTSMAXMAVAMTTNSDIAAIVATASMQYGIIFAGFLVPGQ


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241
2-369 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

ALVGLPGVNGLSKKGKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGHNSCHLISYFEGIQGVKKIKDGYNPATWMLEVTTLAQEDALGVNFAEVYMNSDLYRRNKALISDLSTPPPGSTDLYFPNQYAQSFFTQCIACLWKQHKSYWRNPSYTATRIFFTMVIALIFGTIFLNLGKKVDKRQDLFNSLGSMYAAVIFIGIQNGQCVQPIVDIERTVFYREKAAGMYSALPYAFAQVFIEIPHVFLQTLVYGLIVYSLIGFRLGIYEILLVHVFHVLHFLYFTSMAXMAVAMTTNSDIAAIVATASMQYGIIFAGFLVP

HMMPanther: PTHR19241:SF10
2-369 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

ALVGLPGVNGLSKKGKRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVGPLGHNSCHLISYFEGIQGVKKIKDGYNPATWMLEVTTLAQEDALGVNFAEVYMNSDLYRRNKALISDLSTPPPGSTDLYFPNQYAQSFFTQCIACLWKQHKSYWRNPSYTATRIFFTMVIALIFGTIFLNLGKKVDKRQDLFNSLGSMYAAVIFIGIQNGQCVQPIVDIERTVFYREKAAGMYSALPYAFAQVFIEIPHVFLQTLVYGLIVYSLIGFRLGIYEILLVHVFHVLHFLYFTSMAXMAVAMTTNSDIAAIVATASMQYGIIFAGFLVP

superfamily: SSF52540
17-88 P-loop containing nucleoside triphosphate hydrolases

KRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGG

Gene3D: G3DSA:3.40.50.300
17-94 no description

KRLTIAVELVANPSIIFMDEPTSGLDARAAAIVMRAVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGEEIYVG

Seg: seg
43-54 seg

ARAAAIVMRAVR

HMMPfam: PF01061
IPR013525
184-369 ABC2_membrane
ABC-2 type transporter

TQCIACLWKQHKSYWRNPSYTATRIFFTMVIALIFGTIFLNLGKKVDKRQDLFNSLGSMYAAVIFIGIQNGQCVQPIVDIERTVFYREKAAGMYSALPYAFAQVFIEIPHVFLQTLVYGLIVYSLIGFRLGIYEILLVHVFHVLHFLYFTSMAXMAVAMTTNSDIAAIVATASMQYGIIFAGFLVP

Seg: seg
319-332 seg

LLVHVFHVLHFLYF

Seg: seg
333-344 seg

TSMAXMAVAMTT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox