PRGDB00187977 (Fpr.15871)

From PRG Wiki
Jump to: navigation, search
Fpr.15871
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237594304 (GO869434)
Gene Class Unknown
Domain Type
Gene Species Festuca pratensis

Comment?

CLS_CLiFpEfSpn_58a2_2_g22cLibkit5LD_D11 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 58g22 5', mRNA sequence

DNA Sequence

AGATCATTCACCCATCAACGCACAGAGGGGTCCGTGCGTTGCACTTGTATCATCCTCCGCTTCCTCGCTCCCCTCCCTCGCAGGAGCCCAGCCAGCATGACGCCGGACACCATCCGCACGGTGATCGGGATAATAGGCAATGGAACTGCCCTCATGCTCTTTCTATCCCCAGCGCCGACGTTCTACAATATCTGGAAAAAGAAGACGGTGGAGCAGTACTCAGCGGTGCCGTACCTCGCCACGGCTCCCAACTGCATGATATGGCTGCTCTACGGCCTCCCGATGGTGCAGCCGCATAGCATGCTCATCATCACCATCAATGTCATCGGCCTGGCCATCGAGCTCACGTACATCATGCTCTTCCTCGCGTACTCCGTCGGTGCCGCCCGACATCGGGTCCTCCTCATCCTTGTCGCGGAGGTTTCCTTCGTCGCAGCCTTCGCTGCACTCGTCCTCAACTTCGCACACACCCACGTCCTCAGGTCCATGATCGTCGGCATCCTCTGCGTCGTCGTCGGCACCGGCATGTACGCTGCGCCGCTCTCCGTCATGAAAATGGTGATTCAGACCAACAGCGTGGAGTACATGCCCCTGTTTCTGTCCCTGGCCTCGCTCGCAAGTGGCACTTGCTGGACTGTCTATGCCCTCATCGAGTTCGACATCTACATGACAATCCCCAGCGGGCTGGGCGTCGTGTTCGCTTTGGGACAGGTGATCCTGTACGCGATCTACTACAAGTCGACGCAACAGATCCTCGAGGCCCGCAAGGGCAAAGCCGACCAGATACCCATGACGGAGGTCGTCGTCGACGGGAAGAACGGCAACACCACCAGCTCTGGCGCCGGAAACGGCTACTACTAGACGTAACGTTATGATCTCCAAGTGCATTCATAAATACCTTTGTAATTCTTTGACGGATGATGTGTTGCGCAATAAGTTGTGTTGCCCAGGGCGGTAGTGTGCACCTCGTGTGTTTCTTTTTGTAATGAAAGTTCTAACTATGTCGTAGTGTCTGGACTATCAACTAGAGATGGTAATCAGACGTTGAGTGTTGATCTCCGGTGTTAGTTCTTGAATCTGATTGCTGAAAACTATGACAGTC


Protein sequences

Name Description Sequence
Fpr.15871 translated coding region predicted by ESTScan from UniGene Fpr.15871

RSFTHQRTEGSVRCTCIILRFLAPLPRRSPASMTPDTIRTVIGIIGNGTALMLFLSPAPTFYNIWKKKTVEQYSAVPYLATAPNCMIWLLYGLPMVQPHSMLIITINVIGLAIELTYIMLFLAYSVGAARHRVLLILVAEVSFVAAFAALVLNFAHTHVLRSMIVGILCVVVGTGMYAAPLSVMKMVIQTNSVEYMPLFLSLASLASGTCWTVYALIEFDIYMTIPSGLGVVFALGQVILYAIYYKSTQQILEARKGKADQIPMTEVVVDGKNGNTTSSGAGNGYY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
31-248 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

ASMTPDTIRTVIGIIGNGTALMLFLSPAPTFYNIWKKKTVEQYSAVPYLATAPNCMIWLLYGLPMVQPHSMLIITINVIGLAIELTYIMLFLAYSVGAARHRVLLILVAEVSFVAAFAALVLNFAHTHVLRSMIVGILCVVVGTGMYAAPLSVMKMVIQTNSVEYMPLFLSLASLASGTCWTVYALIEFDIYMTIPSGLGVVFALGQVILYAIYYKST

HMMPfam: PF03083
IPR004316
41-125 MtN3_slv
RAG1-activating protein-1-related

VIGIIGNGTALMLFLSPAPTFYNIWKKKTVEQYSAVPYLATAPNCMIWLLYGLPMVQPHSMLIITINVIGLAIELTYIMLFLAYS

Seg: seg
137-155 seg

LVAEVSFVAAFAALVLNFA

HMMPfam: PF03083
IPR004316
164-248 MtN3_slv
RAG1-activating protein-1-related

IVGILCVVVGTGMYAAPLSVMKMVIQTNSVEYMPLFLSLASLASGTCWTVYALIEFDIYMTIPSGLGVVFALGQVILYAIYYKST

Seg: seg
271-284 seg

GKNGNTTSSGAGNG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox