PRGDB00187978 (Fpr.15072)

From PRG Wiki
Jump to: navigation, search
Fpr.15072
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237608367 (GO878703)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Festuca pratensis

Comment?

CLS_CLiFpEfSpn_78a6_1_c10cLibkit3LD_B05 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 78c10 3', mRNA sequence

DNA Sequence

TTTTTTTTTTTTTTTTCTTTTTTTAAACTCGGAACTCTACTCAACATCCATTGTTTCAAGGAAACATCAAAAATGGTAATCACGTCGTGTTACACATGCACGGGCGTGAGGAAGAAACTACAACTGCTGGTCACACAACCGCATATATACATCCTAGGTCTGTTACAAAGATTAGGCATACACAAAAGAATATATCAACTGCTACAGCAACATCCCTTAATAAAAAGCTTCCAAATCTCCAATCATAGTTTCTGCATCTAGTGCACTTGCGCAGTACTAGGATGGGACTCCGCCACCGGAAAAGGGAAAGCTGTGGCTGATGTGCGCCGCGGTGAAGGCTGCGCTCTCATGGGCCTGGGTGACCTCTGGACTGAACCACCCGATGAGGTCCTCCGGGTGTCAACCTGCGGTGCAGTCACACTGTACTTAGGGTCCTGTAGCTCCTCCAACTTCTCTAGGACCTCGGACATCTGGGGCCGCATTTTGGCCTCCATGCAGATGCACTGCTGGGCGAGGCCCGCGATTGCGTGGGCGCCTTTCTTCGGGTACTGGCCACCCAGCTTCATGTCCATGATGCGGTACAGGCGGCGCTTGTCGCCTAGGTAGGGCCTTGTCCAGTCAACTAGGTTCTGTTCCGTTGTTGGTTTCGATTTGTCCAAGGCTCGCCTTCCTGTCAGCAGCTCGAGTAGTACAACACCAAAGCTATAGACGTCCGCCTTCACAGAGAGGCGACCAGTTGCAATATATTCTGGAGCTGCATAACCTCTAGTACCCATGACTTGCGTAGAAACATGGGTTCTATCCCCGGTTGGACCTGCTTTTGCCAAGCCAAAGTCTGATAGTTTTGCATTGAACTCCGAGTCAAGGAGAATATTTGATGCCTTGAAATCACGGTATATAACTTGATTTTCATCATCATGAAGAACGATAAACCCCTGGCAGCCCCAATAGCAACTTTGAGTCTTATGCCTCAGGGTAAAGGGTCTGCACCACGTCTGAATAGATGATTCTCCAAACTTCCTTTAGGCATTAAC


Protein sequences

Name Description Sequence
Fpr.15072 translated coding region predicted by ESTScan from UniGene Fpr.15072

XLMPKGSLENHLFRRGADPLPXGIRLKVAIGAAQGFIVLHDDENQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTRGYAAPEYIATGRLSVKADVYSFGVVLLELLTGRRALDKSKPTTEQNLVDWTRPYLGDKRRLYRIMDMKLGGQYPKKGAHAIAGLAQQCICMEAKMRPQMSEVLEKLEELQDPKYSVTAPQVDTRRTSSGGSVQRSPRPMRAQPSPRRTSATAFPFPVAESHPSTAQVH

Domains

Domain Start-End Description Sequence

HMMSmart: SM00219
IPR020635
1-197 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XLMPKGSLENHLFRRGADPLPXGIRLKVAIGAAQGFIVLHDDENQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTRGYAAPEYIATGRLSVKADVYSFGVVLLELLTGRRALDKSKPTTEQNLVDWTRPYLGDKRRLYRIMDMKLGGQYPKKGAHAIAGLAQQCICMEAKMRPQMSEVLEKL

ProfileScan: PS50011
IPR000719
1-205 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XLMPKGSLENHLFRRGADPLPXGIRLKVAIGAAQGFIVLHDDENQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTRGYAAPEYIATGRLSVKADVYSFGVVLLELLTGRRALDKSKPTTEQNLVDWTRPYLGDKRRLYRIMDMKLGGQYPKKGAHAIAGLAQQCICMEAKMRPQMSEVLEKLEELQDPKY

superfamily: SSF56112
IPR011009
2-220 Protein kinase-like (PK-like)
Protein kinase-like domain

LMPKGSLENHLFRRGADPLPXGIRLKVAIGAAQGFIVLHDDENQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTRGYAAPEYIATGRLSVKADVYSFGVVLLELLTGRRALDKSKPTTEQNLVDWTRPYLGDKRRLYRIMDMKLGGQYPKKGAHAIAGLAQQCICMEAKMRPQMSEVLEKLEELQDPKYSVTAPQVDTRRTSSG

HMMSmart: SM00220
IPR002290
2-205 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LMPKGSLENHLFRRGADPLPXGIRLKVAIGAAQGFIVLHDDENQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTRGYAAPEYIATGRLSVKADVYSFGVVLLELLTGRRALDKSKPTTEQNLVDWTRPYLGDKRRLYRIMDMKLGGQYPKKGAHAIAGLAQQCICMEAKMRPQMSEVLEKLEELQDPKY

HMMPanther: PTHR24420
3-231 FAMILY NOT NAMED,FAMILY NOT NAMED

MPKGSLENHLFRRGADPLPXGIRLKVAIGAAQGFIVLHDDENQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTRGYAAPEYIATGRLSVKADVYSFGVVLLELLTGRRALDKSKPTTEQNLVDWTRPYLGDKRRLYRIMDMKLGGQYPKKGAHAIAGLAQQCICMEAKMRPQMSEVLEKLEELQDPKYSVTAPQVDTRRTSSGGSVQRSPRPMR

HMMPfam: PF00069
IPR000719
3-196 Pkinase,Ser-thr
Protein kinase, catalytic domain

MPKGSLENHLFRRGADPLPXGIRLKVAIGAAQGFIVLHDDENQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTRGYAAPEYIATGRLSVKADVYSFGVVLLELLTGRRALDKSKPTTEQNLVDWTRPYLGDKRRLYRIMDMKLGGQYPKKGAHAIAGLAQQCICMEAKMRPQMSEVLEK

HMMPanther: PTHR24420:SF897
3-231 SUBFAMILY NOT NAMED

MPKGSLENHLFRRGADPLPXGIRLKVAIGAAQGFIVLHDDENQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTRGYAAPEYIATGRLSVKADVYSFGVVLLELLTGRRALDKSKPTTEQNLVDWTRPYLGDKRRLYRIMDMKLGGQYPKKGAHAIAGLAQQCICMEAKMRPQMSEVLEKLEELQDPKYSVTAPQVDTRRTSSGGSVQRSPRPMR

Gene3D: G3DSA:1.10.510.10
3-214 no description

MPKGSLENHLFRRGADPLPXGIRLKVAIGAAQGFIVLHDDENQVIYRDFKASNILLDSEFNAKLSDFGLAKAGPTGDRTHVSTQVMGTRGYAAPEYIATGRLSVKADVYSFGVVLLELLTGRRALDKSKPTTEQNLVDWTRPYLGDKRRLYRIMDMKLGGQYPKKGAHAIAGLAQQCICMEAKMRPQMSEVLEKLEELQDPKYSVTAPQVDT

PatternScan: PS00108
IPR008271
46-58 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox