PRGDB00187985 (Ncr.31032)

From PRG Wiki
Jump to: navigation, search
Ncr.31032
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 164424392 (XM_957041)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Neurospora crassa

Comment?

Neurospora crassa OR74A serine

DNA Sequence

ATGTCGTGGAAACTCACAAAGAAGCTGAAGGAGACCCATTTGGGTCCTCTTTCAAGCCCCTTCTCCCGCTCGCCCTCTACCTCCACCATCACAGATAAGGAAGACAAGAGCCAAGCGGGCAGCTCGGGAGCAGCCACCCCTTCGAACGAGAACACCATTGGTAGGCGCTCAGCCCGTCTTGTTCACTCGGCCATCACAAGATTAACCTCTTTTCCTTTCACAGCCGCCTCGGAAGCCCTTACGCAAGCTCCCATCGTCAAGCCTCCTAAGCCCGGTATCCTCGTCGTCACCCTCCACGAGGGTTCCGGCTTCTCGCTACCCGAACAGTATCGCAATGTCTTTTCCTCAAACCATGGCGGTAACTCGATGTCGACGGGAAGTGCCCTTAACGTTGCAGGCTCCATTCGCACCAACAACTCGTCACGAACAGCCAACTTCCTGAGCGGTTCTTCGCGCCCACAGAGCTCGGGCGGCTTTGGCGCCATTCCTACAAATCACGGCCGTATCTCCACAAAGTATATGCCCTATGCCCTCATAGATTTTGACAAGGTTCAAGTTTTTGTCAACTCGGTCGAAGGCAACCCCGAAAACCCCCTCTGGGCCGGCTCCAACACTCAGTACAAGTTCGATGTGTCTCGAGTTACGGAGCTTGCCGTACATCTTTACATCAGGAACCCCAACGCGGCGCCTGGCTCCGGCCGCAGCCAAGACATCTTCCTTGGTGTTGTCCGTATTAACCCCAGATTCGAGGAGAAGCAGCAGTTCGTCGATGACCCCAAGGCCAGCAAGAAGGACCGGGAAAAGGCCGCCGCCGACTTTGCCAACAAGGAGCGCGCCCTCGGACACAGCGGTGTGGAGTGGGTCGACGTTCAGTATGGTACCGGAAAGCTCAAGATCGGCGTCGAGTATGTGGAGAACCGCGCCGGTAAGCTCAAGATTGAGGATTTCGAGCTCCTCAAGGTTGTCGGCAAGGGCTCGTTTGGTAAGGTCATGCAGGTGCGCAAGAAGGACACGAACCGTATTTACGCTCTCAAGACGATTCGCAAGGCGCACATCATCTCGCGTTCCGAAGTCGCCCACACGCTCGCTGAGCGATCCGTTCTGGCCCAGATCAACAACCCGTTTATCGTGCCGCTCAAGTTCACCTTCCAGAGTCCCGAGAAGCTATACTTTGTCCTCGCCTTTGTCAATGGTGGTGAGCTGTTCCATCATTTGCAGAAAGAGCAGCGATTCGACGTCAACCGCAGTCGTTTCTACACGGCCGAACTGCTGTGTGCGCTCGAATGCCTTCACGGTTTCAACGTCATTTACCGTGATCTCAAGCCGGAAAACATTCTTCTCGACTACCAAGGTCACATCGCTCTCTGCGATTTCGGTCTCTGCAAGCTGGACATGAAGGATGAGGACCGCACCAACACATTTTGCGGCACCCCTGAGTATTTGGCGCCCGAATTGCTGATGGGTAATGGTTACAACAAGACTGTCGATTGGTGGACATTGGGTGTGCTTTTGTACGAGATGTTGACGGGTCTCCCGCCTTTCTACGATGAGAACACCAACGAGATGTACCGCAAGATCCTCAGCGAACCGCTGCACTTCCCCGGACCCGAGGTTGTACCCCCAGCTGCCAAGGACCTCTTGACCAAGCTGCTCAACCGCGACCCGCAACAACGTCTCGGTGCCAACGGGGCGGCCGAGATCAAGGCGCACCCCTTCTTCCACGCCATAGATTGGCGCAAGTTGTTGCAGCGCAAGTACGAGCCTGCGTTCAAGCCCAATGTGGTTGACGCGCTCGACACCGCCAACTTCGACCCTGAGTTCACATCGGAACTTCCTCAGGATTCTTACGTGGAAGGACCGATTCTGTCAGAGACGATGCAGAACCAGTTCACGGGCTTCAGTTACAACCGTCCTATTGCTGGTCTCGGGGATGCGGGTGGCAGTGTTAAGGACCCATCATTCGCGAGCAGTCTTCAAGACAACAGCAGCAGGAGATAG


Protein sequences

Name Description Sequence
Ncr.31032 translated coding region predicted by ESTScan from UniGene Ncr.31032

MSWKLTKKLKETHLGPLSSPFSRSPSTSTITDKEDKSQAGSSGAATPSNENTIGRRSARLVHSAITRLTSFPFTAASEALTQAPIVKPPKPGILVVTLHEGSGFSLPEQYRNVFSSNHGGNSMSTGSALNVAGSIRTNNSSRTANFLSGSSRPQSSGGFGAIPTNHGRISTKYMPYALIDFDKVQVFVNSVEGNPENPLWAGSNTQYKFDVSRVTELAVHLYIRNPNAAPGSGRSQDIFLGVVRINPRFEEKQQFVDDPKASKKDREKAAADFANKERALGHSGVEWVDVQYGTGKLKIGVEYVENRAGKLKIEDFELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVAHTLAERSVLAQINNPFIVPLKFTFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELLCALECLHGFNVIYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDRTNTFCGTPEYLAPELLMGNGYNKTVDWWTLGVLLYEMLTGLPPFYDENTNEMYRKILSEPLHFPGPEVVPPAAKDLLTKLLNRDPQQRLGANGAAEIKAHPFFHAIDWRKLLQRKYEPAFKPNVVDALDTANFDPEFTSELPQDSYVEGPILSETMQNQFTGFSYNRPIAGLGDAGGSVKDPSFASSLQDNSSRR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24354:SF102
1-656 PTHR24354:SF102

MSWKLTKKLKETHLGPLSSPFSRSPSTSTITDKEDKSQAGSSGAATPSNENTIGRRSARLVHSAITRLTSFPFTAASEALTQAPIVKPPKPGILVVTLHEGSGFSLPEQYRNVFSSNHGGNSMSTGSALNVAGSIRTNNSSRTANFLSGSSRPQSSGGFGAIPTNHGRISTKYMPYALIDFDKVQVFVNSVEGNPENPLWAGSNTQYKFDVSRVTELAVHLYIRNPNAAPGSGRSQDIFLGVVRINPRFEEKQQFVDDPKASKKDREKAAADFANKERALGHSGVEWVDVQYGTGKLKIGVEYVENRAGKLKIEDFELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVAHTLAERSVLAQINNPFIVPLKFTFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELLCALECLHGFNVIYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDRTNTFCGTPEYLAPELLMGNGYNKTVDWWTLGVLLYEMLTGLPPFYDENTNEMYRKILSEPLHFPGPEVVPPAAKDLLTKLLNRDPQQRLGANGAAEIKAHPFFHAIDWRKLLQRKYEPAFKPNVVDALDTANFDPEFTSELPQDSYVEGPILSETMQNQFTGFSYNRPIAGLGDAGGSVKDPSFAS

HMMPanther: PTHR24354
1-656 PTHR24354,SERINE/THREONINE-PROTEIN KINASE YPK-RELATED

MSWKLTKKLKETHLGPLSSPFSRSPSTSTITDKEDKSQAGSSGAATPSNENTIGRRSARLVHSAITRLTSFPFTAASEALTQAPIVKPPKPGILVVTLHEGSGFSLPEQYRNVFSSNHGGNSMSTGSALNVAGSIRTNNSSRTANFLSGSSRPQSSGGFGAIPTNHGRISTKYMPYALIDFDKVQVFVNSVEGNPENPLWAGSNTQYKFDVSRVTELAVHLYIRNPNAAPGSGRSQDIFLGVVRINPRFEEKQQFVDDPKASKKDREKAAADFANKERALGHSGVEWVDVQYGTGKLKIGVEYVENRAGKLKIEDFELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVAHTLAERSVLAQINNPFIVPLKFTFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELLCALECLHGFNVIYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDRTNTFCGTPEYLAPELLMGNGYNKTVDWWTLGVLLYEMLTGLPPFYDENTNEMYRKILSEPLHFPGPEVVPPAAKDLLTKLLNRDPQQRLGANGAAEIKAHPFFHAIDWRKLLQRKYEPAFKPNVVDALDTANFDPEFTSELPQDSYVEGPILSETMQNQFTGFSYNRPIAGLGDAGGSVKDPSFAS

Gene3D: G3DSA:3.30.200.20
310-398 G3DSA:3.30.200.20

KLKIEDFELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVAHTLAERSVLAQINNPFIVPLKFTFQSPEKLYFVLAFVNG

superfamily: SSF56112
IPR011009
311-665 Kinase_like
Protein kinase-like domain

LKIEDFELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVAHTLAERSVLAQINNPFIVPLKFTFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELLCALECLHGFNVIYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDRTNTFCGTPEYLAPELLMGNGYNKTVDWWTLGVLLYEMLTGLPPFYDENTNEMYRKILSEPLHFPGPEVVPPAAKDLLTKLLNRDPQQRLGANGAAEIKAHPFFHAIDWRKLLQRKYEPAFKPNVVDALDTANFDPEFTSELPQDSYVEGPILSETMQNQFTGFSYNRPIAGLGDAGGSVKDPSFASSLQDNSSRR

HMMSmart: SM00220
IPR002290
316-573 S_TKc
Serine/threonine- / dual-specificity protein kinas

FELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVAHTLAERSVLAQINNPFIVPLKFTFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELLCALECLHGFNVIYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDRTNTFCGTPEYLAPELLMGNGYNKTVDWWTLGVLLYEMLTGLPPFYDENTNEMYRKILSEPLHFPGPEVVPPAAKDLLTKLLNRDPQQRLGANGAAEIKAHPFF

HMMPfam: PF00069
IPR000719
316-573 Pkinase,Ser-thr
Protein kinase, catalytic domain

FELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVAHTLAERSVLAQINNPFIVPLKFTFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELLCALECLHGFNVIYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDRTNTFCGTPEYLAPELLMGNGYNKTVDWWTLGVLLYEMLTGLPPFYDENTNEMYRKILSEPLHFPGPEVVPPAAKDLLTKLLNRDPQQRLGANGAAEIKAHPFF

ProfileScan: PS50011
IPR000719
316-573 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FELLKVVGKGSFGKVMQVRKKDTNRIYALKTIRKAHIISRSEVAHTLAERSVLAQINNPFIVPLKFTFQSPEKLYFVLAFVNGGELFHHLQKEQRFDVNRSRFYTAELLCALECLHGFNVIYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDRTNTFCGTPEYLAPELLMGNGYNKTVDWWTLGVLLYEMLTGLPPFYDENTNEMYRKILSEPLHFPGPEVVPPAAKDLLTKLLNRDPQQRLGANGAAEIKAHPFF

PatternScan: PS00107
IPR017441
322-349 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGKGSFGKVMQVRKKDTNRIYALKTIRK

Gene3D: G3DSA:1.10.510.10
399-623 G3DSA:1.10.510.10

GELFHHLQKEQRFDVNRSRFYTAELLCALECLHGFNVIYRDLKPENILLDYQGHIALCDFGLCKLDMKDEDRTNTFCGTPEYLAPELLMGNGYNKTVDWWTLGVLLYEMLTGLPPFYDENTNEMYRKILSEPLHFPGPEVVPPAAKDLLTKLLNRDPQQRLGANGAAEIKAHPFFHAIDWRKLLQRKYEPAFKPNVVDALDTANFDPEFTSELPQDSYVEGPILS

PatternScan: PS00108
IPR008271
435-447 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDLKPENILL

ProfileScan: PS51285
IPR000961
574-645 AGC_KINASE_CTER
AGC-kinase, C-terminal

HAIDWRKLLQRKYEPAFKPNVVDALDTANFDPEFTSELPQDSYVEGPILSETMQNQFTGFSYNRPIAGLGDA

HMMSmart: SM00133
IPR000961
574-637 S_TK_X
AGC-kinase, C-terminal

HAIDWRKLLQRKYEPAFKPNVVDALDTANFDPEFTSELPQDSYVEGPILSETMQNQFTGFSYNR

HMMPfam: PF00433
IPR017892
597-638 Pkinase_C
Protein kinase, C-terminal

ALDTANFDPEFTSELPQDSYVEGPILSETMQNQFTGFSYNRP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox