PRGDB00187992 (Pvr.12352)

From PRG Wiki
Jump to: navigation, search
Pvr.12352
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 304452049 (HO251228)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Panicum virgatum

Comment?

CCTW5027.b1 CCTW Panicum virgatum Carthage normalized leaf Panicum virgatum cDNA clone CCTW5027 5', mRNA sequence

DNA Sequence

AGCCTTATCAAAGGTAAACCATAAGAATCTTATGAACCTCGTGGGTTACTGTGAAGATGAAGAACCATTTACCCGGATGATGGTGTTCGAGTATGTTTCAAATGGATCACTGTTTGAGCGCTTGCATGTCAAAGAAGCCGAGCACTTGGATTGGCAGTCACGCCTACGGATAGCTATGGGAGTAGTATACTGTCTGGGCTACAGGTACCAGCAGAATGCTCCTGTAACCCTAAGGAATCTAAACAGTTCATGCATATACTTGACTGAAGATGATGCCACCAAGGTTTCAGACATCAGCTTTGGTGTTGACAAGAAAGAAGATGAAAATGATGCTCCTGATGAGTACAGCACAGTGTATAAGTTCGCTCTGCTACTGCTTGAGACAATCTCTGGAAGGCGTCCATATTCTGACGACGACGGCCTCCTAGCTCTATGGGCACGCAGATATCTTAATGGTGCTAGCCCTGTGATGGGCATGGTCGACTCAACGCTAAATTCAGTCCCGGAGGAGCATGTTAGTGCATTCTCAGAGCTGATTCGTTTATGCATAAGTGAGGACCGAAGTCAGAGGCCGACAATGGCAGAGCTTACCAAGAGGATGCAAGAAATCACTGGGATCACTCAAGATCAGGCGATTCCCGAGGAAAAGTGCTCTGTGGTGGGCTGAACTTGAAATCATTACGGCGTAGAGAGAGTCAATTGTCCTGACTTGCAGCAACTCTGCAATTCTGACGTTTGATAGAAGAAATGTAGAGATTGTACAGTTTAGTGCTTTTAGGCAGGCATTCAGTTGTA


Protein sequences

Name Description Sequence
Pvr.12352 translated coding region predicted by ESTScan from UniGene Pvr.12352

XALSKVNHKNLMNLVGYCEDEEPFTRMMVFEYVSNGSLFERLHVKEAEHLDWQSRLRIAMGVVYCLGYRYQQNAPVTLRNLNSSCIYLTEDDATKVSDISFGVDKKEDENDAPDEYSTVYKFALLLLETISGRRPYSDDDGLLALWARRYLNGASPVMGMVDSTLNSVPEEHVSAFSELIRLCISEDRSQRPTMAELTKRMQEITGITQDQAIPEEKCSVVG

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-204 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XALSKVNHKNLMNLVGYCEDEEPFTRMMVFEYVSNGSLFERLHVKEAEHLDWQSRLRIAMGVVYCLGYRYQQNAPVTLRNLNSSCIYLTEDDATKVSDISFGVDKKEDENDAPDEYSTVYKFALLLLETISGRRPYSDDDGLLALWARRYLNGASPVMGMVDSTLNSVPEEHVSAFSELIRLCISEDRSQRPTMAELTKRMQEI

HMMSmart: SM00219
IPR020635
1-201 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XALSKVNHKNLMNLVGYCEDEEPFTRMMVFEYVSNGSLFERLHVKEAEHLDWQSRLRIAMGVVYCLGYRYQQNAPVTLRNLNSSCIYLTEDDATKVSDISFGVDKKEDENDAPDEYSTVYKFALLLLETISGRRPYSDDDGLLALWARRYLNGASPVMGMVDSTLNSVPEEHVSAFSELIRLCISEDRSQRPTMAELTKRM

superfamily: SSF56112
IPR011009
2-205 Protein kinase-like (PK-like)
Protein kinase-like domain

ALSKVNHKNLMNLVGYCEDEEPFTRMMVFEYVSNGSLFERLHVKEAEHLDWQSRLRIAMGVVYCLGYRYQQNAPVTLRNLNSSCIYLTEDDATKVSDISFGVDKKEDENDAPDEYSTVYKFALLLLETISGRRPYSDDDGLLALWARRYLNGASPVMGMVDSTLNSVPEEHVSAFSELIRLCISEDRSQRPTMAELTKRMQEIT

HMMPfam: PF07714
IPR001245
3-110 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

LSKVNHKNLMNLVGYCEDEEPFTRMMVFEYVSNGSLFERLHVKEAEHLDWQSRLRIAMGVVYCLGYRYQQNAPVTLRNLNSSCIYLTEDDATKVSDISFGVDKKEDEN

HMMPanther: PTHR24420:SF458
3-214 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LSKVNHKNLMNLVGYCEDEEPFTRMMVFEYVSNGSLFERLHVKEAEHLDWQSRLRIAMGVVYCLGYRYQQNAPVTLRNLNSSCIYLTEDDATKVSDISFGVDKKEDENDAPDEYSTVYKFALLLLETISGRRPYSDDDGLLALWARRYLNGASPVMGMVDSTLNSVPEEHVSAFSELIRLCISEDRSQRPTMAELTKRMQEITGITQDQAIP

HMMPanther: PTHR24420
3-214 FAMILY NOT NAMED,FAMILY NOT NAMED

LSKVNHKNLMNLVGYCEDEEPFTRMMVFEYVSNGSLFERLHVKEAEHLDWQSRLRIAMGVVYCLGYRYQQNAPVTLRNLNSSCIYLTEDDATKVSDISFGVDKKEDENDAPDEYSTVYKFALLLLETISGRRPYSDDDGLLALWARRYLNGASPVMGMVDSTLNSVPEEHVSAFSELIRLCISEDRSQRPTMAELTKRMQEITGITQDQAIP

Gene3D: G3DSA:1.10.510.10
3-101 no description

LSKVNHKNLMNLVGYCEDEEPFTRMMVFEYVSNGSLFERLHVKEAEHLDWQSRLRIAMGVVYCLGYRYQQNAPVTLRNLNSSCIYLTEDDATKVSDISF

Gene3D: G3DSA:1.10.510.10
113-208 no description

PDEYSTVYKFALLLLETISGRRPYSDDDGLLALWARRYLNGASPVMGMVDSTLNSVPEEHVSAFSELIRLCISEDRSQRPTMAELTKRMQEITGIT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox