PRGDB00188135 (At.65247)

From PRG Wiki
Jump to: navigation, search
At.65247
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 334185743 (NM_114412)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana concanavalin A-like lectin kinase-like protein (AT3G45430) mRNA, complete cds

DNA Sequence

ATGTCTAAAGGATTGTTTCTAATCTGGTTGATCTCCTCTTTTCATCTTATCTCTTTCTCAACTTCATCAAAAGATACCAGTTTTGTCTTCAACGGCTTTGGTCAATCAAATCTTGCTCTTGATGGGTCTGCTACATTGCTTCCCAATGGATTACTACAGCTTGCAAAAGACTCCCAGCATCAAATGGGTCATGCTTTCATCAAGAAGCCAATTGACTTCAGCTCCTCTAAACCACTCTCATTTTCAACACATTTCGTCTGTGCTCTGGTGCCTAAGCCGGGATTTGAAGGCGGTCACGGCATTACCTTTGTGATATCTCCTACTGTGGATTTCACACGGGCGCAACCAACTCGGTACATGGGGATATTCAACGCATCAACAAATGGATCTCCCTCTTCTCACCTGTTTGCTGTTGAGCTCGACACTGTTAGGAATCCAGATTTTCGTGAGACAAACAATAATCACATTGGGATTGATGTGAACAATCCCATTTCAGTCGAATCAGCACCGGCTTCTTACTTTTCCAAGACAGCACAGAAGAATGTGAGCATAAACCTCTCAAGTGGAAAACCTATACAGGTCTGGGTTGATTACCATGGAAATGTACTTAATGTTTCTGTGGCGCCTCTTGAAGCTGAGAAGCCAAGTTTGCCTCTTTTGTCACGATCCATGAATCTCTCAGAAATCTTCTCGAGGAGAAGATTGTTTGTTGGCTTCGCTGCAGCAACAGGGACATCAATCAGTTACCATTATCTTCTTGGGTGGAGTTTCAGCACAAACAGAGAATTATCTCAGTTACTTGACTTCTCAAAACTTCCTCAAGTTCCACGGCCTAGAGCTGAGCATAAGAAAGTACAATTTGCGCTGATTATCGCTCTGCCTGTTATACTTGCTATCGTAGTAATGGCTGTTCTTGCAGGAGTTTATTACCACAGGAAGAAGAAGTATGCAGAAGTAAGTGAACCATGGGAAAAGAAATATGGTACACACCGGTTCTCTTACAAATCCTTATACATAGCAACTAAAGGTTTCCACAAGGATAGATTTCTTGGAAGAGGAGGTTTTGGAGAAGTGTACAGAGGAGATCTCCCTTTGAACAAAACTGTAGCTGTGAAGAGAGTGTCCCATGATGGCGAACAAGGGATGAAGCAATTTGTGGCTGAAGTCGTGAGCATGAAAAGTCTGAAACACAGGAATCTCGTTCCACTTCTCGGGTATTGCAGGAGAAAAGGCGAGCTTTTACTGGTTTCCGAGTACATGCCTAATGGTAGTCTTGACCAACACTTGTTTGATGATCAAAGTCCGGTTCTTTCTTGGTCCCAAAGATTTGTGATTCTCAAGGGTATAGCCTCAGCTCTCTTCTATCTCCATACAGAAGCTGAACAAGTTGTTCTGCACCGAGATATCAAAGCTTCCAACGTTATGTTAGATGCTGAGTTGAACGGTAGGTTAGGAGATTTTGGTATGGCTAGGTTTCATGACCATGGAGGCAATGCAGCCACAACAGCAGCGGTTGGCACTGTAGGGTACATGGCACCTGAGCTAATAACAATGGGAGCTTCCACTATAACCGATGTATATGCTTTCGGTGTTTTCTTGCTTGAAGTAGCCTGTGGGAGGAAACCTGTGGAATTCGGGGTGCAAGTTGAGAAACGATTTCTGATCAAATGGGTTTGTGAATGCTGGAAGAAAGATTCTTTGCTTGATGCTAAAGATCCAAGATTGGGAGAAGAATTTGTACCCGAGGAAGTCGAGTTGGTTATGAAACTCGGGCTGCTATGTACAAACATTGTGCCAGAATCTAGACCAGCAATGGGACAAGTGGTTCTTTACTTAAGTGGGAACTTACCATTGCCGGATTTCTCACCATATACACTTGGAATCGGCTCGTTTACTCCTGTAGTTGTCGATGCAGCCTCACTTACCGTCTCATTTACTTCGAGGAACTGGTCAGCTCCTTCGGCCTCTTCTTCTTCAGCCAATAACTCAAAGGATCATGAACAACCATTGGAATTTAAGAGCTGA


Protein sequences

Name Description Sequence
At.65247 translated coding region predicted by ESTScan from UniGene At.65247

MSKGLFLIWLISSFHLISFSTSSKDTSFVFNGFGQSNLALDGSATLLPNGLLQLAKDSQHQMGHAFIKKPIDFSSSKPLSFSTHFVCALVPKPGFEGGHGITFVISPTVDFTRAQPTRYMGIFNASTNGSPSSHLFAVELDTVRNPDFRETNNNHIGIDVNNPISVESAPASYFSKTAQKNVSINLSSGKPIQVWVDYHGNVLNVSVAPLEAEKPSLPLLSRSMNLSEIFSRRRLFVGFAAATGTSISYHYLLGWSFSTNRELSQLLDFSKLPQVPRPRAEHKKVQFALIIALPVILAIVVMAVLAGVYYHRKKKYAEVSEPWEKKYGTHRFSYKSLYIATKGFHKDRFLGRGGFGEVYRGDLPLNKTVAVKRVSHDGEQGMKQFVAEVVSMKSLKHRNLVPLLGYCRRKGELLLVSEYMPNGSLDQHLFDDQSPVLSWSQRFVILKGIASALFYLHTEAEQVVLHRDIKASNVMLDAELNGRLGDFGMARFHDHGGNAATTAAVGTVGYMAPELITMGASTITDVYAFGVFLLEVACGRKPVEFGVQVEKRFLIKWVCECWKKDSLLDAKDPRLGEEFVPEEVELVMKLGLLCTNIVPESRPAMGQVVLYLSGNLPLPDFSPYTLGIGSFTPVVVDAASLTVSFTSRNWSAPSASSSSANNSKDHEQPLEFKS

Domains

Domain Start-End Description Sequence

superfamily: SSF49899
IPR008985
25-261 ConA_like_lec_gl
Concanavalin A-like lectin/glucanase

DTSFVFNGFGQSNLALDGSATLLPNGLLQLAKDSQHQMGHAFIKKPIDFSSSKPLSFSTHFVCALVPKPGFEGGHGITFVISPTVDFTRAQPTRYMGIFNASTNGSPSSHLFAVELDTVRNPDFRETNNNHIGIDVNNPISVESAPASYFSKTAQKNVSINLSSGKPIQVWVDYHGNVLNVSVAPLEAEKPSLPLLSRSMNLSEIFSRRRLFVGFAAATGTSISYHYLLGWSFSTNR

HMMPfam: PF00139
IPR001220
25-258 Lectin_legB
Legume lectin domain

DTSFVFNGFGQSNLALDGSATLLPNGLLQLAKDSQHQMGHAFIKKPIDFSSSKPLSFSTHFVCALVPKPGFEGGHGITFVISPTVDFTRAQPTRYMGIFNASTNGSPSSHLFAVELDTVRNPDFRETNNNHIGIDVNNPISVESAPASYFSKTAQKNVSINLSSGKPIQVWVDYHGNVLNVSVAPLEAEKPSLPLLSRSMNLSEIFSRRRLFVGFAAATGTSISYHYLLGWSFS

HMMPanther: PTHR24420:SF626
101-620 PTHR24420:SF626

ITFVISPTVDFTRAQPTRYMGIFNASTNGSPSSHLFAVELDTVRNPDFRETNNNHIGIDVNNPISVESAPASYFSKTAQKNVSINLSSGKPIQVWVDYHGNVLNVSVAPLEAEKPSLPLLSRSMNLSEIFSRRRLFVGFAAATGTSISYHYLLGWSFSTNRELSQLLDFSKLPQVPRPRAEHKKVQFALIIALPVILAIVVMAVLAGVYYHRKKKYAEVSEPWEKKYGTHRFSYKSLYIATKGFHKDRFLGRGGFGEVYRGDLPLNKTVAVKRVSHDGEQGMKQFVAEVVSMKSLKHRNLVPLLGYCRRKGELLLVSEYMPNGSLDQHLFDDQSPVLSWSQRFVILKGIASALFYLHTEAEQVVLHRDIKASNVMLDAELNGRLGDFGMARFHDHGGNAATTAAVGTVGYMAPELITMGASTITDVYAFGVFLLEVACGRKPVEFGVQVEKRFLIKWVCECWKKDSLLDAKDPRLGEEFVPEEVELVMKLGLLCTNIVPESRPAMGQVVLYLSGNLPLPD

HMMPanther: PTHR24420
101-620 PTHR24420,FAMILY NOT NAMED

ITFVISPTVDFTRAQPTRYMGIFNASTNGSPSSHLFAVELDTVRNPDFRETNNNHIGIDVNNPISVESAPASYFSKTAQKNVSINLSSGKPIQVWVDYHGNVLNVSVAPLEAEKPSLPLLSRSMNLSEIFSRRRLFVGFAAATGTSISYHYLLGWSFSTNRELSQLLDFSKLPQVPRPRAEHKKVQFALIIALPVILAIVVMAVLAGVYYHRKKKYAEVSEPWEKKYGTHRFSYKSLYIATKGFHKDRFLGRGGFGEVYRGDLPLNKTVAVKRVSHDGEQGMKQFVAEVVSMKSLKHRNLVPLLGYCRRKGELLLVSEYMPNGSLDQHLFDDQSPVLSWSQRFVILKGIASALFYLHTEAEQVVLHRDIKASNVMLDAELNGRLGDFGMARFHDHGGNAATTAAVGTVGYMAPELITMGASTITDVYAFGVFLLEVACGRKPVEFGVQVEKRFLIKWVCECWKKDSLLDAKDPRLGEEFVPEEVELVMKLGLLCTNIVPESRPAMGQVVLYLSGNLPLPD

superfamily: SSF56112
IPR011009
314-620 Kinase_like
Protein kinase-like domain

KKYAEVSEPWEKKYGTHRFSYKSLYIATKGFHKDRFLGRGGFGEVYRGDLPLNKTVAVKRVSHDGEQGMKQFVAEVVSMKSLKHRNLVPLLGYCRRKGELLLVSEYMPNGSLDQHLFDDQSPVLSWSQRFVILKGIASALFYLHTEAEQVVLHRDIKASNVMLDAELNGRLGDFGMARFHDHGGNAATTAAVGTVGYMAPELITMGASTITDVYAFGVFLLEVACGRKPVEFGVQVEKRFLIKWVCECWKKDSLLDAKDPRLGEEFVPEEVELVMKLGLLCTNIVPESRPAMGQVVLYLSGNLPLPD

ProfileScan: PS50011
IPR000719
344-625 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FHKDRFLGRGGFGEVYRGDLPLNKTVAVKRVSHDGEQGMKQFVAEVVSMKSLKHRNLVPLLGYCRRKGELLLVSEYMPNGSLDQHLFDDQSPVLSWSQRFVILKGIASALFYLHTEAEQVVLHRDIKASNVMLDAELNGRLGDFGMARFHDHGGNAATTAAVGTVGYMAPELITMGASTITDVYAFGVFLLEVACGRKPVEFGVQVEKRFLIKWVCECWKKDSLLDAKDPRLGEEFVPEEVELVMKLGLLCTNIVPESRPAMGQVVLYLSGNLPLPDFSPYT

HMMPfam: PF00069
IPR000719
345-555 Pkinase,Ser-thr
Protein kinase, catalytic domain

HKDRFLGRGGFGEVYRGDLPLNKTVAVKRVSHDGEQGMKQFVAEVVSMKSLKHRNLVPLLGYCRRKGELLLVSEYMPNGSLDQHLFDDQSPVLSWSQRFVILKGIASALFYLHTEAEQVVLHRDIKASNVMLDAELNGRLGDFGMARFHDHGGNAATTAAVGTVGYMAPELITMGASTITDVYAFGVFLLEVACGRKPVEFGVQVEKRFLI

PatternScan: PS00107
IPR017441
350-372 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGEVYRGDLPLNKTVAVK

PatternScan: PS00108
IPR008271
464-476 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDIKASNVML






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox