PRGDB00188137 (At.68184)

From PRG Wiki
Jump to: navigation, search
At.68184
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 334184896 (NM_001202811)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase domain-containing protein (AT2G43230) mRNA, complete cds

DNA Sequence

tctttcttttcttagctttttcttttatcttttgtgttttctgtcttttcttttccgtagttatttgggattccaaatttttttcattcCTAAATTTCTCCACGAGCTCATCACCTCCTTTCGTCTCTGCCTCTCATTTGTCTACAAACATTTTTTCCTTTTGATTCGTCTCTCTGGTTTATTGCTCGTTGATCGTTTGTTTCTAAATTGCATTCTGATTTCTGATGGATCGTGATTTTCATCGTCGTGGTCAAGTGGTCAATCAAGATCAACGCGCAACAAATTCTAATGTTTTTACAAAATTTGAAAATACTTATCTACAAATAACAGCTCATTTATGTGTTTTGGTGAAAACGCAGGCGAATGATCGTACACAAAGCAACTTTGTTCGATTGGATAAACCGAGAGCTGTAGACGATCTTGATATAGGCAAGAGAGGGAAGATGCGTAGGTGGTTGTGCTGTTCTTGTCGTGTACAAGAATCTTACCCATCAGCTGAAAATAACCGATTGAAAACCCCTCCTACTCGCCATTACGACTATGGACGTAACAACAAGAAAACACCAGCTCCTGTGAAGCCTCCTGTTTTGAAGGAGCCTCCGCCTATTGATGTCCCCGCAATGTCATTGGTTGAGCTCAAAGAAAAGACTCAGAATTTTGGATCAAAGGCATTGATTGGAGAAGGATCCTATGGAAGAGTGTACTACGCAAACTTTAATGATGGGAAGGCCGTGGCTGTGAAAAAGCTTGATAATGCATCTGAACCCGAAACAAATGTCGAGTTCTTGACTCAGGTCTCTAAAGTTTCGAGGCTGAAAAGTGACAATTTTGTTCAGCTTCTTGGTTATTGTGTAGAAGGGAACCTTCGTGTCCTTGCTTATGAGTTTGCCACAATGAGATCATTGCACGACATCTTACACGGGAGAAAGGGAGTGCAAGGAGCACAACCTGGTCCAACACTTGAGTGGATGCAACGAGTCCGAGTTGCGGTTGATGCAGCTAAAGGATTAGAATACTTACACGAGAAAGTTCAACCTGCGGTTATACACAGAGATATTCGATCTAGCAATGTGCTTATTTTCGAAGATTTCAAAGCCAAGATTGCTGACTTTAATCTTTCCAATCAAGCTCCTGATATGGCTGCTCGTCTTCATTCCACTAGAGTTTTGGGGACCTTCGGTTATCATGCACCAGAATATGCGATGACAGGACAGTTGACACAGAAGAGTGATGTTTACAGTTTTGGAGTTGTGCTTTTGGAACTTCTTACCGGGAGAAAACCGGTTGATCATACTATGCCTCGTGGTCAACAGAGTCTTGTCACTTGGGCTACTCCAAGGCTGAGTGAAGACAAAGTGAAACAATGTGTTGATCCAAAACTCAAAGGAGAGTATCCTCCTAAAGCAGTGGCAAAGCTTGCAGCGGTTGCAGCGTTGTGTGTGCAATACGAAGCAGAGTTTAGGCCAAACATGAGCATTGTAGTAAAAGCTCTTCAACCGCTCTTGAGGTCAGCAACAGCTGCTGCTCCTCCAACACCTCAACCTTGATTCTTCTTTGTGGTTCTTGCTTACTGATTATCATGGCTTCAAGGTTTTGTCTTCACTTTATTCTTTCTATCTACCATGGAATGTAAATGGTTATTAAGGGGAGGTGGTGAGGAGCAATTGGGATTTCACTCCATGGAAATGATCTGTGTTAACTGCTTTTTGATGGGTTGATTCTTATGAAATATTCTA


Protein sequences

Name Description Sequence
At.68184 translated coding region predicted by ESTScan from UniGene At.68184

MDRDFHRRGQVVNQDQRATNSNVFTKFENTYLQITAHLCVLVKTQANDRTQSNFVRLDKPRAVDDLDIGKRGKMRRWLCCSCRVQESYPSAENNRLKTPPTRHYDYGRNNKKTPAPVKPPVLKEPPPIDVPAMSLVELKEKTQNFGSKALIGEGSYGRVYYANFNDGKAVAVKKLDNASEPETNVEFLTQVSKVSRLKSDNFVQLLGYCVEGNLRVLAYEFATMRSLHDILHGRKGVQGAQPGPTLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLIFEDFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLRSATAAAPPTPQP

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
115-423 Kinase_like
Protein kinase-like domain

APVKPPVLKEPPPIDVPAMSLVELKEKTQNFGSKALIGEGSYGRVYYANFNDGKAVAVKKLDNASEPETNVEFLTQVSKVSRLKSDNFVQLLGYCVEGNLRVLAYEFATMRSLHDILHGRKGVQGAQPGPTLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLIFEDFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKAL

HMMPanther: PTHR24420:SF416
118-440 PTHR24420:SF416,SUBFAMILY NOT NAMED

KPPVLKEPPPIDVPAMSLVELKEKTQNFGSKALIGEGSYGRVYYANFNDGKAVAVKKLDNASEPETNVEFLTQVSKVSRLKSDNFVQLLGYCVEGNLRVLAYEFATMRSLHDILHGRKGVQGAQPGPTLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLIFEDFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLRSATAAAPPTPQP

HMMPanther: PTHR24420
118-440 PTHR24420,FAMILY NOT NAMED

KPPVLKEPPPIDVPAMSLVELKEKTQNFGSKALIGEGSYGRVYYANFNDGKAVAVKKLDNASEPETNVEFLTQVSKVSRLKSDNFVQLLGYCVEGNLRVLAYEFATMRSLHDILHGRKGVQGAQPGPTLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLIFEDFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLRSATAAAPPTPQP

Gene3D: G3DSA:3.30.200.20
130-221 G3DSA:3.30.200.20

VPAMSLVELKEKTQNFGSKALIGEGSYGRVYYANFNDGKAVAVKKLDNASEPETNVEFLTQVSKVSRLKSDNFVQLLGYCVEGNLRVLAYEF

ProfileScan: PS50011
IPR000719
145-427 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGSKALIGEGSYGRVYYANFNDGKAVAVKKLDNASEPETNVEFLTQVSKVSRLKSDNFVQLLGYCVEGNLRVLAYEFATMRSLHDILHGRKGVQGAQPGPTLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLIFEDFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLL

HMMPfam: PF07714
IPR001245
149-423 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

ALIGEGSYGRVYYANFNDGKAVAVKKLDNASEPETNVEFLTQVSKVSRLKSDNFVQLLGYCVEGNLRVLAYEFATMRSLHDILHGRKGVQGAQPGPTLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLIFEDFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKAL

PatternScan: PS00107
IPR017441
151-174 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYYANFNDGKAVAVKK

Gene3D: G3DSA:1.10.510.10
226-422 G3DSA:1.10.510.10

SLHDILHGRKGVQGAQPGPTLEWMQRVRVAVDAAKGLEYLHEKVQPAVIHRDIRSSNVLIFEDFKAKIADFNLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKA

PatternScan: PS00109
IPR008266
273-285 PROTEIN_KINASE_TYR
Tyrosine-protein kinase, active site

VIHRDIRSSNVLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox