PRGDB00188140 (At.74913)

From PRG Wiki
Jump to: navigation, search
At.74913
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 222138214 (FJ154117)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana truncated At3g13062 mRNA, complete cds

DNA Sequence

GTCCTAGTCCTAGTCCACGCGCGAATATACAAACGTCTTAAAGCCATTTGATAGAACCGATTTCCAAGGGTTTTGCTCAGAAAAAACACAGAGAGAGATTTTGGAATTCGATGAATAGTGGTGATACCTTATCGACGTTAGCTCAATTTATCTCCTCTTCCGAGAGATTTTTCCGGCGAGCTGACGGTGATGTAGTCTTTTGTTATTGCTGGGCCACCGTGCTCGCACTTGTCTTCATTCTTCTCTACCAATTCTTCCTTTCCCGGAAATTCCGATTCTTCAGTCATGCTTCTTCTTCTTCCCCTGTCGTCTCGGTTTCTCAATCTCTCAGCTCCCAATCAGGAATATCTACTACACTTGTTTCTGATGAAGATCTAAAGGGTCTGATTCAAAAATTGGGGGAAAGAAGTGAGGATGCTGAGATATGGGAAGATGTTATTAAGAAAAGCAACCCTCGTATCTCCTACACTGCTAAATGCTGCAAACCAACAGATGGTAGTCCCATGAAGTATCTGAGTACAACTGTGTTTGAGGATTGCTCCCCAGAGGTTTTGAGGGACTTTTACATGGACAATGAATACAGGAAACAATGGGACAAGACTGTGGTTGAGCATGAGCAATTGCAGGTTGACAGTAATAGTGGGATTGAGATTGGTCGCACTATAAAAAAGTTTCCCTTGTTGACTCCAAGGGAGTATGTATTAGCGTGGAAATTGTGGGAGGGGAAGGATAAGTTTTACTGTTTCATCAAGGAATGTGATCACAATATGGTGCCGCAACAGAGGAAGTATGTACGTTTCCTGGTAGGAACGCTTGTGAGATACACATGGTTCACCAGGAGGATGCTGGATTAAATGTTGAGATGGCAAAGCTTGCTTTCTCAAGAGGCATATGGAGTTACGTTTGTAAGATGGAAAATGCACTTCGCAAGTACATTGCAACCAGTCATCGACCCCAAGGGCCCACATTATCTGCTGTAAGCTTAATGAAAAAGATTCCATCGGAGTTAGAAAGTCAGACAGACGACATTACAAACTCCTCGGGAACTACCACTAGTGGTATGCACACAGGTGAAGGAGCCAAACGGAAGAAACTGTTGAGAAAGCCTTCAAAGAAACTGATAGCAAATGGTATGTTACTTGTGGGCGGTGCCGTTGGTGGTGCAATCTGCCTGTCTCGTGGTCACTCCGCCTTAGGGGCAAAGGTCGCGTTGGCTTACTTCTTGTCGAAGATGAGAAAGCGTGGAGCTCAACTGAGTCAAACTTCCCAAAACGCTGTTGGATCGGGACTTGGACACAGTTGTGGTCTCTCTCCTAATGTTTCGGTGTCTGCTTCATTTTTAGCTGTACATTTCTCTATTCACACGTCCAGATTTATTCGCCTTTTCACTCAATAACGTCATTCAAAAATCCTAAAAGAAAACAGAAGAAACTGAATTTGCCATTTTTGGTTACTGCCACACCATTTCCAATTTAGTTTTCTTTCATGACCTATCTAGCTTCTTTGTTTCCTCTCCTTTGGTTTTCGTGTGTTTCCTTCATCCCCAAGGAAACCCGGAACCAGCCCTGGGTTTCTCTCTGGATCATCTCTTTTGTTATTTTACAGATTTTGATTTTTGAGCTTAAAACTGTCGGATCATGGGACCAAATCTGCAGCGGATCGTACTTGTCTTCATTGCATGTTTCGGAATCTTCACCTCCGTTGTTCTTGCAAAAACCGATAGCCAAGACGTATCTGCTCTTAATGACGCTTATAAGAGCATGAACTCTCCATCAAAACTCAAAGGCTGGTCTTCAAGCGGAGGCGATCCTTGTGGCGATTCGTGGGATGGCATTACTTGCAAAGGCTCTTCTGTTACTGAAATAAAAGTATCTGGACGTGGACTCAGTGGATCTTTAGGTTACCAGCTTGGAAACTTGAAATCGCTCACTTACCTTGATGTAAGCAAGAACAATCTTAACGGAAACTTACCCTACCAGCTTCCTGACAAGCTTACTTATCTAGATGGCTCTGAGAATGACTTCAACGGTAATGTGCCATATTCGGTGTCTCTCATGAACGACCTCAGTTACCTAAACCTTGGCCGTAACAACCTCAATGGTGAACTCAGTGACATGTTTCAAAAGCTTCCAAAACTTGAAACAATTGATCTTTCTTCCAATCAACTCACGGGAAAACTACCGCAGAGTTTTGCCAATCTAACAGGTCTTAAAACACTGCATTTGCAAGAAAACCAATTCAAAGGCTCTATAAATGCTCTCAGGGACCTCCCTCAGATTGATGATGTAAACGTAGCAAACAATCAATTTACTGGTTGGATCCCAAACGAGTTGAAGAATATTGGAAACCTTGAAACTGGAGGAAACAAGTGGTCAAGCGGTAGAGCTCCTTCACCACCTCCGGGAACCCGTCACATAGACAGAAACTCATCAGGAGGCGGTGGAGGAAGCAGCAAGGCTCTGACACTAGGAGTTATAATAGCGGTGTCTTCTATAGGTGGACTCATTTTATTTGCAGGGTTGATTGCATTGATTTCTCGAAGAAAGAACTCTAATGATTCTTCTCACTTTTTCGACGACGAGAAAGGAACCAACCGAAGCAAGCCACTCTTCACACCACAATCCTCTCAGATGCTTCAATTCGATAATATGGAAGAATTCAAAAACCAGAAGACAGTTGATTCTAATACTTCACTTGAAACAAAGCCTTCTGTTAAAAGAACTTCTTCTGTCAGTTTCAAGAACTCTCCTACTTTTCATCTCATACCTTCTACCCAAGTGGCTGCTACCCCTGACCGTTCCTCCACCTCCCAAGACTCTCCTGATACACGCGGTGTGAAAGCGTTTTCACTAGCGGATTTGCAGAATACCGCGTCTTGTTTCTCGCCGAATCGCCTTCTTGGTGAAGGAACCATTGGACGTGTTTATAAAGCTAAATTTCAGGATGGAAGGGAAAAGGCAATCCGGAAGAGTTTTCACACATAGTGTCGAGTATCTCGAGTATTCACCACAAGAATATGGCAGAACTCGTGGGTTATTGTTCAGAACAAGGAAGAAATATGCTTGTTTATGAGTATTTCACAAGTGGATCACTTCACAGATTTCTTCACCTGTCTGATGATTTCAGCAAACCATTGACGTGGAACACCAGAATCCGAATCGCTCTCGGAACTGCTAAAGCTATAGAGTACCTTCATGAAACATGTTCGCCTCCGCTAGTTCACAAGAACATCAAGTCATCAAACATTTTACTTGATAATGAGCTAAATCCCCGCCTCTCAGACTATGGCTTGGCAAACTTTCACCACCGCACAAGTCAGAATCTTGGAGTTGGATACAATGCCCCAGAATGCACAGATCCCTCCGCTTACACACAAAAGAGCGACGTGTACAGCTTTGGTGTGGTGATGCTTGAGCTGCTAACTGGTCGAAAGCCTTATGACAGTGGGAGGCCAAAAGCAGAACAGTCTTTAGTTCGTTGGGCAAAGCCGCAGCTTAAAGACATGGATACTCTGGATGAAATGGTGGATCCCGCGTTGTGCGGACTCTACGCTCCAGAATCTGTATCATCATTCGCGGATATAGTTTCCATCTGCGTAATGACGGAGCCTGGACTTAGGCCTCCAGTGTCAAATGTGGTGGAGGCATTGAAGAGGCTAGTGTAGTCTAGTGCCTCAAGTCATTTTGAAGCCCCCAAAGTATTAAAAGAAGAAGAATAACTCTTCTGGAGATTGCGGCTAAAACCTGAG


Protein sequences

Name Description Sequence
At.74913 translated coding region predicted by ESTScan from UniGene At.74913

XPSPSPRANIQTSXSHLIEPISKGFAQKKHRERFWNSMNSGDTLSTLAQFISSSERFFRRADGDVVFCYCWATVLALVFILLYQFFLSRKFRFFSHASSSSPVVSVSQSLSSQSGISTTLVSDEDLKGLIQKLGERSEDAEIWEDVIKKSNPRISYTAKCCKPTDGSPMKYLSTTVFEDCSPEVLRDFYMDNEYRKQWDKTVVEHEQLQVDSNSGIEIGRTIKKFPLLTPREYVLAWKLWEGKDKFYCFIKECDHNMVPQQRKYXTFPGRNACEIHMVHQEDAGLNVEMAKLAFSRGIWSYVCKMENALRKYIATSHRPQGPTLSAVSLMKKIPSELESQTDDITNSSGTTTSGMHTGEGAKRKKLLRKPSKKLIANGMLLVGGAVGGAICLSRGHSALGAKVALAYFLSKMRKRGAQLSQTSQNAVGSGLGHSCGLSPNVSVSASFLAVHFSIHRPDLFAFSLNNVIQKSXKKTEETEFAIFGYCHTISNLVFFHDLSSFFVSSPLVFVCFLHPQGNPEPALGFSLDHLFCYFTDFDFXAXNCRIMGPNLQRIVLVFIACFGIFTSVVLAKTDSQDVSALNDAYKSMNSPSKLKGWSSSGGDPCGDSWDGITCKGSSVTEIKVSGRGLSGSLGYQLGNLKSLTYLDVSKNNLNGNLPYQLPDKLTYLDGSENDFNGNVPYSVSLMNDLSYLNLGRNNLNGELSDMFQKLPKLETIDLSSNQLTGKLPQSFANLTGLKTLHLQENQFKGSINALRDLPQIDDVNVANNQFTGWIPNELKNIGNLETGGNKWSSGRAPSPPPGTRHIDRNSSGGGGGSSKALTLGVIIAVSSIGGLILFAGLIALISRRKNSNDSSHFFDDEKGTNRSKPLFTPQSSQMLQFDNMEEFKNQKTVDSNTSLETKPSVKRTSSVSFKNSPTFHLIPSTQVAATPDRSSTSQDSPDTRGVKAFSLADLQNTASCFSPNRLLGEGTIGRVYKAKFQDGREKAXPEEFSHIVSSISSIHHKNMAELVGYCSEQGRNMLVYEYFTSGSLHRFLHLSDDFSKPLTWNTRIRIALGTAKAIEYLHETCSPPLVHKNIKSSNILLDNELNPRLSDYGLANFHHRTSQNLGVGYNAPECTDPSAYTQKSDVYSFGVVMLELLTGRKPYDSGRPKAEQSLVRWAKPQLKDMDTLDEMVDPALCGLYAPESVSSFADIVSICVMTEPGLRPPVSNVVEALKRLV

Domains

Domain Start-End Description Sequence

Seg: seg
95-117 seg

SHASSSSPVVSVSQSLSSQSGIS

superfamily: SSF55961
120-312 Bet v1-like

LVSDEDLKGLIQKLGERSEDAEIWEDVIKKSNPRISYTAKCCKPTDGSPMKYLSTTVFEDCSPEVLRDFYMDNEYRKQWDKTVVEHEQLQVDSNSGIEIGRTIKKFPLLTPREYVLAWKLWEGKDKFYCFIKECDHNMVPQQRKYXTFPGRNACEIHMVHQEDAGLNVEMAKLAFSRGIWSYVCKMENALRKY

Gene3D: G3DSA:3.30.530.20
IPR023393
120-312 no description
START-like domain

LVSDEDLKGLIQKLGERSEDAEIWEDVIKKSNPRISYTAKCCKPTDGSPMKYLSTTVFEDCSPEVLRDFYMDNEYRKQWDKTVVEHEQLQVDSNSGIEIGRTIKKFPLLTPREYVLAWKLWEGKDKFYCFIKECDHNMVPQQRKYXTFPGRNACEIHMVHQEDAGLNVEMAKLAFSRGIWSYVCKMENALRKY

ProfileScan: PS50848
IPR002913
139-264 START
Lipid-binding START

DAEIWEDVIKKSNPRISYTAKCCKPTDGSPMKYLSTTVFEDCSPEVLRDFYMDNEYRKQWDKTVVEHEQLQVDSNSGIEIGRTIKKFPLLTPREYVLAWKLWEGKDKFYCFIKECDHNMVPQQRKY

Seg: seg
345-358 seg

TNSSGTTTSGMHTG

Seg: seg
362-374 seg

KRKKLLRKPSKKL

Seg: seg
380-389 seg

LLVGGAVGGA

Seg: seg
498-513 seg

LSSFFVSSPLVFVCFL

HMMPanther: PTHR24420
544-1221 FAMILY NOT NAMED,FAMILY NOT NAMED

CRIMGPNLQRIVLVFIACFGIFTSVVLAKTDSQDVSALNDAYKSMNSPSKLKGWSSSGGDPCGDSWDGITCKGSSVTEIKVSGRGLSGSLGYQLGNLKSLTYLDVSKNNLNGNLPYQLPDKLTYLDGSENDFNGNVPYSVSLMNDLSYLNLGRNNLNGELSDMFQKLPKLETIDLSSNQLTGKLPQSFANLTGLKTLHLQENQFKGSINALRDLPQIDDVNVANNQFTGWIPNELKNIGNLETGGNKWSSGRAPSPPPGTRHIDRNSSGGGGGSSKALTLGVIIAVSSIGGLILFAGLIALISRRKNSNDSSHFFDDEKGTNRSKPLFTPQSSQMLQFDNMEEFKNQKTVDSNTSLETKPSVKRTSSVSFKNSPTFHLIPSTQVAATPDRSSTSQDSPDTRGVKAFSLADLQNTASCFSPNRLLGEGTIGRVYKAKFQDGREKAXPEEFSHIVSSISSIHHKNMAELVGYCSEQGRNMLVYEYFTSGSLHRFLHLSDDFSKPLTWNTRIRIALGTAKAIEYLHETCSPPLVHKNIKSSNILLDNELNPRLSDYGLANFHHRTSQNLGVGYNAPECTDPSAYTQKSDVYSFGVVMLELLTGRKPYDSGRPKAEQSLVRWAKPQLKDMDTLDEMVDPALCGLYAPESVSSFADIVSICVMTEPGLRPPVSNVVEALKRLV

HMMPanther: PTHR24420:SF463
544-1221 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

CRIMGPNLQRIVLVFIACFGIFTSVVLAKTDSQDVSALNDAYKSMNSPSKLKGWSSSGGDPCGDSWDGITCKGSSVTEIKVSGRGLSGSLGYQLGNLKSLTYLDVSKNNLNGNLPYQLPDKLTYLDGSENDFNGNVPYSVSLMNDLSYLNLGRNNLNGELSDMFQKLPKLETIDLSSNQLTGKLPQSFANLTGLKTLHLQENQFKGSINALRDLPQIDDVNVANNQFTGWIPNELKNIGNLETGGNKWSSGRAPSPPPGTRHIDRNSSGGGGGSSKALTLGVIIAVSSIGGLILFAGLIALISRRKNSNDSSHFFDDEKGTNRSKPLFTPQSSQMLQFDNMEEFKNQKTVDSNTSLETKPSVKRTSSVSFKNSPTFHLIPSTQVAATPDRSSTSQDSPDTRGVKAFSLADLQNTASCFSPNRLLGEGTIGRVYKAKFQDGREKAXPEEFSHIVSSISSIHHKNMAELVGYCSEQGRNMLVYEYFTSGSLHRFLHLSDDFSKPLTWNTRIRIALGTAKAIEYLHETCSPPLVHKNIKSSNILLDNELNPRLSDYGLANFHHRTSQNLGVGYNAPECTDPSAYTQKSDVYSFGVVMLELLTGRKPYDSGRPKAEQSLVRWAKPQLKDMDTLDEMVDPALCGLYAPESVSSFADIVSICVMTEPGLRPPVSNVVEALKRLV

superfamily: SSF52058
571-786 L domain-like,LRR

AKTDSQDVSALNDAYKSMNSPSKLKGWSSSGGDPCGDSWDGITCKGSSVTEIKVSGRGLSGSLGYQLGNLKSLTYLDVSKNNLNGNLPYQLPDKLTYLDGSENDFNGNVPYSVSLMNDLSYLNLGRNNLNGELSDMFQKLPKLETIDLSSNQLTGKLPQSFANLTGLKTLHLQENQFKGSINALRDLPQIDDVNVANNQFTGWIPNELKNIGNLET

HMMPfam: PF08263
IPR013210
575-614 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SQDVSALNDAYKSMNSPSKLKGWSSSGGDPCGDSWDGITC

Gene3D: G3DSA:3.80.10.10
575-786 no description

SQDVSALNDAYKSMNSPSKLKGWSSSGGDPCGDSWDGITCKGSSVTEIKVSGRGLSGSLGYQLGNLKSLTYLDVSKNNLNGNLPYQLPDKLTYLDGSENDFNGNVPYSVSLMNDLSYLNLGRNNLNGELSDMFQKLPKLETIDLSSNQLTGKLPQSFANLTGLKTLHLQENQFKGSINALRDLPQIDDVNVANNQFTGWIPNELKNIGNLET

Seg: seg
692-703 seg

LNLGRNNLNGEL

HMMPfam: PF13855
711-769 LRR_8,Leucine rich repeat

PKLETIDLSSNQLTGKLPQSFANLTGLKTLHLQENQFKGSINALRDLPQIDDVNVANNQ

Seg: seg
810-818 seg

SSGGGGGSS

Seg: seg
830-846 seg

SSIGGLILFAGLIALIS

superfamily: SSF56112
IPR011009
931-1217 Protein kinase-like (PK-like)
Protein kinase-like domain

PDRSSTSQDSPDTRGVKAFSLADLQNTASCFSPNRLLGEGTIGRVYKAKFQDGREKAXPEEFSHIVSSISSIHHKNMAELVGYCSEQGRNMLVYEYFTSGSLHRFLHLSDDFSKPLTWNTRIRIALGTAKAIEYLHETCSPPLVHKNIKSSNILLDNELNPRLSDYGLANFHHRTSQNLGVGYNAPECTDPSAYTQKSDVYSFGVVMLELLTGRKPYDSGRPKAEQSLVRWAKPQLKDMDTLDEMVDPALCGLYAPESVSSFADIVSICVMTEPGLRPPVSNVVEAL

Gene3D: G3DSA:3.30.200.20
944-1013 no description

RGVKAFSLADLQNTASCFSPNRLLGEGTIGRVYKAKFQDGREKAXPEEFSHIVSSISSIHHKNMAELVGY

HMMSmart: SM00219
IPR020635
961-1217 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSPNRLLGEGTIGRVYKAKFQDGREKAXPEEFSHIVSSISSIHHKNMAELVGYCSEQGRNMLVYEYFTSGSLHRFLHLSDDFSKPLTWNTRIRIALGTAKAIEYLHETCSPPLVHKNIKSSNILLDNELNPRLSDYGLANFHHRTSQNLGVGYNAPECTDPSAYTQKSDVYSFGVVMLELLTGRKPYDSGRPKAEQSLVRWAKPQLKDMDTLDEMVDPALCGLYAPESVSSFADIVSICVMTEPGLRPPVSNVVEAL

HMMSmart: SM00220
IPR002290
961-1221 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSPNRLLGEGTIGRVYKAKFQDGREKAXPEEFSHIVSSISSIHHKNMAELVGYCSEQGRNMLVYEYFTSGSLHRFLHLSDDFSKPLTWNTRIRIALGTAKAIEYLHETCSPPLVHKNIKSSNILLDNELNPRLSDYGLANFHHRTSQNLGVGYNAPECTDPSAYTQKSDVYSFGVVMLELLTGRKPYDSGRPKAEQSLVRWAKPQLKDMDTLDEMVDPALCGLYAPESVSSFADIVSICVMTEPGLRPPVSNVVEALKRLV

ProfileScan: PS50011
IPR000719
961-1220 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSPNRLLGEGTIGRVYKAKFQDGREKAXPEEFSHIVSSISSIHHKNMAELVGYCSEQGRNMLVYEYFTSGSLHRFLHLSDDFSKPLTWNTRIRIALGTAKAIEYLHETCSPPLVHKNIKSSNILLDNELNPRLSDYGLANFHHRTSQNLGVGYNAPECTDPSAYTQKSDVYSFGVVMLELLTGRKPYDSGRPKAEQSLVRWAKPQLKDMDTLDEMVDPALCGLYAPESVSSFADIVSICVMTEPGLRPPVSNVVEALKRL

HMMPfam: PF07714
IPR001245
982-1215 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

DGREKAXPEEFSHIVSSISSIHHKNMAELVGYCSEQGRNMLVYEYFTSGSLHRFLHLSDDFSKPLTWNTRIRIALGTAKAIEYLHETCSPPLVHKNIKSSNILLDNELNPRLSDYGLANFHHRTSQNLGVGYNAPECTDPSAYTQKSDVYSFGVVMLELLTGRKPYDSGRPKAEQSLVRWAKPQLKDMDTLDEMVDPALCGLYAPESVSSFADIVSICVMTEPGLRPPVSNVVE

Seg: seg
993-1004 seg

SHIVSSISSIHH

Gene3D: G3DSA:1.10.510.10
1014-1214 no description

CSEQGRNMLVYEYFTSGSLHRFLHLSDDFSKPLTWNTRIRIALGTAKAIEYLHETCSPPLVHKNIKSSNILLDNELNPRLSDYGLANFHHRTSQNLGVGYNAPECTDPSAYTQKSDVYSFGVVMLELLTGRKPYDSGRPKAEQSLVRWAKPQLKDMDTLDEMVDPALCGLYAPESVSSFADIVSICVMTEPGLRPPVSNVV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox