PRGDB00188143 (At.75311)

From PRG Wiki
Jump to: navigation, search
At.75311
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 19873614 (AV831554)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

AV831554 RAFL9 Arabidopsis thaliana cDNA clone RAFL09-90-O09 5', mRNA sequence

DNA Sequence

GGAGaaaaaaaaaatcaaagaaaaaaaGTTTATTGCATTGTTGAGGTCAGATGAAGATGACAATATGGAGCTTGTGTTTAATCTTGTCCCTTTCTAATTCAAAACTGGTTTTGGCTTCTCATGTTAAGCACTTATGTCGTCAAGACCAGAAGAATGCTCTTTTGGAGTTTAAGAACGAGTTTTATGTCCATGAGTTCAACTCCAATGGGATTGTTGGTGTTAAGAAGACAGAGAAGTGGAGGAACAACACCGATTGCTGTTCTTGGGATGGTATCTCTTGTGATCCTAAAACGGGTAAGGTGGTAGAGTTAGACCTCATGAACAGTTTTCTTAATGGTCCTTTGAGATATGATAGTAGCTTGTTTAGACTACAACATCTTCATAATCTGGATCTTGGCTCGAATAATTTTTCGGGTATTCTACCGGATTCCATAGGCAGCCCTNAAATATTNGAGGGGTTTTGAGTCTTGGTGATTGTAATCTCTTTGGAAAGATTCCTTCTTCACTTGGAAATNTTACTTTATCTCCCTAATCCTGATCTTTCTGTTAATGAT


Protein sequences

Name Description Sequence
At.75311 translated coding region predicted by ESTScan from UniGene At.75311

MTIWSLCLILSLSNSKLVLASHVKHLCRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFSGILPDSIGSPX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-127 FAMILY NOT NAMED,FAMILY NOT NAMED

MTIWSLCLILSLSNSKLVLASHVKHLCRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFSGILPDSIG

HMMPanther: PTHR24420:SF911
1-127 DISEASE RESISTANCE FAMILY PROTEIN

MTIWSLCLILSLSNSKLVLASHVKHLCRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFSGILPDSIG

superfamily: SSF52058
25-128 L domain-like,LRR

HLCRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFSGILPDSIGS

Gene3D: G3DSA:3.80.10.10
27-127 no description

CRQDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCDPKTGKVVELDLMNSFLNGPLRYDSSLFRLQHLHNLDLGSNNFSGILPDSIG

HMMPfam: PF08263
IPR013210
29-76 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

QDQKNALLEFKNEFYVHEFNSNGIVGVKKTEKWRNNTDCCSWDGISCD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox