PRGDB00188144 (At.75348)

From PRG Wiki
Jump to: navigation, search
At.75348
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 42456410 (BX829911)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana Full-length cDNA Complete sequence from clone GSLTFB45ZF03 of Flowers and buds of strain col-0 of Arabidopsis thaliana (thale cress)

DNA Sequence

CAATGATTAAAGAATTTCCTGCATCCATTGTTGGACACTGGTGTCGTCTTGATTTTCTTCAGATAGGCAGCAGAAGCCTCAAGAGATTAACACATGTCCCAGAAAGTGTAACACATCTAGACCTACGCAACACTCATATAAAGATGATCCCAGATTGCGTCATAGGTCTTCCGCATCTAGTATCTCTTCTCGTCGAAAACTGCACAAAACTGGTGTCAATTCAGGGTCATTCCCCTTCGCTGGTGACCCTATTTGCAGACCACTGTATATCACTCAAGAGCGTATGCTGCTCTTTCCACGGACCAATCTCGAAATTGATGTTCTACAACTGTCTGAAACTGGATAAGGAATCAAAAAGAGGAATCATACAACAATCGGGTAACAAGTCTATATGCTTGCCAGGTAAAGAAATCCCTGCAGAGTTCACTCACCAAACTATAGGGAACTTGATAACCATCTCCCTGGCTCCAGGTTGTAAGGAGGCTTATTCTACGTTCTCAAGATTTAAGGCTTGCCTCCTGCTTTCGCCAATCAAGAATTTCGCATTTAATAAGATAAATTGTTTTCTAAGAAGCAAAGGTGTCGAAATTAGTCGCACTACAGAGTCTATATATCCTTTTGTGTCTGGTGGATCTCTATCAGAACATCTGTCTATCTTTTGTGGCGACTCATTTCCTGAAGAAAACAGAAGCCTTATGGACGTGACTTCGAACGAGATTCTGTTTGATTTCAGCTCCAGTTATGTCGAGATTATGGAATGTGGTGTAAAGATCTTTTTAAGTAGTGGCATTGAAGTGGGCTACTGTAAAACTGGAGGCAACAGAAACCACCACATAGATGGAGAAGCAGAAGCGTTTAAGGTAACTCAAGTTGAAAACAGTATACATACAGGCCACTGGAGTTGGCTTAGGAAGCTTCGTCTGGGGAAGAAGAAGATGAAGAATAATAAGACAGAGCTTAGTTCGAGACCAGTCTCAGGATTTAGTGATCTGACTCGGGGAATCTTTATAAGGTTTTAGGAGCCTGAAGCTGTTGAGCTCACTAAAGATGAAAGAATGACAGATGTTTCGAGTTTACTATGTATTGGTTCCCTTGTGGTCTgtttttttctttctgtttttttCGGGCAACCCCTTGTGGTCTCTGTTTTGTTGCTTTTTTCTTGCTTCTTTCTTGAGATGCAATGAGCTGCATGACAGACAGATCTTGTTGTGTTTGTATGTGCGAAACAAAAAAAGATTTCAGTTTTCTTGTTCTTATATATACTCCCTCTGGGAGAGGCCTTGTTAATCTATCCAAAGAAGCACGATGCTCTTTGGTGCATTGGGGATGCTCATACTTCATATGGGGTTTTGACTCCTGATCAAACTGAGGCTAGAGATCACTTTGTAGAAAGCTATTCTGCTTTTTCTACAAGCTTTGGAGGAGCAACCGGAGAATGCTCACTATGCGAGATTACTGGTATTGGCTTCCAAGGGTCCAGAACTAAATACAGAGGTTTACAAACATGGTTTAGGTCTACAACCATTGGGCGGCACCGCAGGACCACCATCTACCAGTGCGAAGATTACTTTGAGAAAGCTACTCAGTTCCTACAACAAGctttttttgtttgctctctttttAGTATTCATCAAATTCAGATGAGCTTTAATGATAAGGTTATATTCGTTTGATTGAATCTACTGAAAATGTGAAGTCTTTATGT


Protein sequences

Name Description Sequence
At.75348 translated coding region predicted by ESTScan from UniGene At.75348

XMIKEFPASIVGHWCRLDFLQIGSRSLKRLTHVPESVTHLDLRNTHIKMIPDCVIGLPHLVSLLVENCTKLVSIQGHSPSLVTLFADHCISLKSVCCSFHGPISKLMFYNCLKLDKESKRGIIQQSGNKSICLPGKEIPAEFTHQTIGNLITISLAPGCKEAYSTFSRFKACLLLSPIKNFAFNKINCFLRSKGVEISRTTESIYPFVSGGSLSEHLSIFCGDSFPEENRSLMDVTSNEILFDFSSSYVEIMECGVKIFLSSGIEVGYCKTGGNRNHHIDGEAEAFKVTQVENSIHTGHWSWLRKLRLGKKKMKNNKTELSSRPVSGFSDLTRGIFIRF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
2-259 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MIKEFPASIVGHWCRLDFLQIGSRSLKRLTHVPESVTHLDLRNTHIKMIPDCVIGLPHLVSLLVENCTKLVSIQGHSPSLVTLFADHCISLKSVCCSFHGPISKLMFYNCLKLDKESKRGIIQQSGNKSICLPGKEIPAEFTHQTIGNLITISLAPGCKEAYSTFSRFKACLLLSPIKNFAFNKINCFLRSKGVEISRTTESIYPFVSGGSLSEHLSIFCGDSFPEENRSLMDVTSNEILFDFSSSYVEIMECGVKIF

superfamily: SSF52058
3-114 L domain-like,LRR

IKEFPASIVGHWCRLDFLQIGSRSLKRLTHVPESVTHLDLRNTHIKMIPDCVIGLPHLVSLLVENCTKLVSIQGHSPSLVTLFADHCISLKSVCCSFHGPISKLMFYNCLKL

Gene3D: G3DSA:3.80.10.10
6-89 no description

FPASIVGHWCRLDFLQIGSRSLKRLTHVPESVTHLDLRNTHIKMIPDCVIGLPHLVSLLVENCTKLVSIQGHSPSLVTLFADHC

Seg: seg
303-317 seg

LRKLRLGKKKMKNNK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox