PRGDB00188147 (Bdi.4037)

From PRG Wiki
Jump to: navigation, search
Bdi.4037
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 78008259 (DV476647)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Brachypodium distachyon

Comment?

5564_D08_G16ZE5_058 Brachypodium distachyon developing spike EST library Brachypodium distachyon cDNA clone 5564_D08_G16, mRNA sequence

DNA Sequence

CCACGCGTCCGGGTCAATGGCTCACTTAGGACAGCTTTGCTGAAGAATGCCAAGAGCCTTGATCGGCGGAAGAGGCTAATTATTGCCATGGATACAGCTTTTGGAATGGAGTACTTGCATAACAAGAACATAGTGCACTTTGACCTGAAAAGTGACAATTTACTTGTTAATTTAAGGGATCCTCAACGCCCAATATGCAAGGTTGGCGATCTAGGGCTTTCTAAAGTCAAGTGTCAGACCCTCATCTCTGGTGGTGTGAGGGGGACGCTTCCATGGATGGCCCCAGAACTTCTTAATGGAAGTAGCAGCTTGGTTTCTGAAAAGGTTGATGTCTTCTCTTTTGGGATTGTTCTGTGGGAACTCCTCACAGGAGAAGAACCATATGCAGATTTGCATTATGGTGTTATTATCGGTGGCATAGTGAGCAACACTCTGCGACCGCCGGTGCCCGACTCATGTGACCTGGAGTGGAAATCACTGATGGAGCAATGCTGGGCGACGGAACCATCTGAACGGCCAAGCTTTACACAGATTGCTGTCCGGTTGCGCTCCATGGCTGCACCCCCCCAGAGGGTGTAAACCTAAGGCCACCGACCAGGGACAGCAATCTTCAAACTTGTGGGGTGCCATCCGTGGACAAGTTCTTCAGTGCCGCCGTTATTGCGTGTCTAGGAATTCAGCATATATATGCATCCATTGTGTCCCTAGGATCTGTTCATACCCCTTCATTGTTTCATATCTTGTAATCATAAGTTACCAGCCCCCCCTGTGTCTAGAAGTGTCTCGCAATGGACGTCCC


Protein sequences

Name Description Sequence
Bdi.4037 translated coding region predicted by ESTScan from UniGene Bdi.4037

PRVRVNGSLRTALLKNAKSLDRRKRLIIAMDTAFGMEYLHNKNIVHFDLKSDNLLVNLRDPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVLWELLTGEEPYADLHYGVIIGGIVSNTLRPPVPDSCDLEWKSLMEQCWATEPSERPSFTQIAVRLRSMAAPPQRV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-186 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

PRVRVNGSLRTALLKNAKSLDRRKRLIIAMDTAFGMEYLHNKNIVHFDLKSDNLLVNLRDPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVLWELLTGEEPYADLHYGVIIGGIVSNTLRPPVPDSCDLEWKSLMEQCWATEPSERPSFTQIAVRLRSMA

HMMSmart: SM00220
IPR002290
2-186 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RVRVNGSLRTALLKNAKSLDRRKRLIIAMDTAFGMEYLHNKNIVHFDLKSDNLLVNLRDPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVLWELLTGEEPYADLHYGVIIGGIVSNTLRPPVPDSCDLEWKSLMEQCWATEPSERPSFTQIAVRLRSMA

HMMSmart: SM00219
IPR020635
4-182 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RVNGSLRTALLKNAKSLDRRKRLIIAMDTAFGMEYLHNKNIVHFDLKSDNLLVNLRDPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVLWELLTGEEPYADLHYGVIIGGIVSNTLRPPVPDSCDLEWKSLMEQCWATEPSERPSFTQIAVRL

HMMPanther: PTHR23257:SF393
5-187 SUBFAMILY NOT NAMED

VNGSLRTALLKNAKSLDRRKRLIIAMDTAFGMEYLHNKNIVHFDLKSDNLLVNLRDPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVLWELLTGEEPYADLHYGVIIGGIVSNTLRPPVPDSCDLEWKSLMEQCWATEPSERPSFTQIAVRLRSMAA

HMMPanther: PTHR23257
5-187 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

VNGSLRTALLKNAKSLDRRKRLIIAMDTAFGMEYLHNKNIVHFDLKSDNLLVNLRDPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVLWELLTGEEPYADLHYGVIIGGIVSNTLRPPVPDSCDLEWKSLMEQCWATEPSERPSFTQIAVRLRSMAA

superfamily: SSF56112
IPR011009
6-182 Protein kinase-like (PK-like)
Protein kinase-like domain

NGSLRTALLKNAKSLDRRKRLIIAMDTAFGMEYLHNKNIVHFDLKSDNLLVNLRDPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVLWELLTGEEPYADLHYGVIIGGIVSNTLRPPVPDSCDLEWKSLMEQCWATEPSERPSFTQIAVRL

HMMPfam: PF07714
IPR001245
6-181 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

NGSLRTALLKNAKSLDRRKRLIIAMDTAFGMEYLHNKNIVHFDLKSDNLLVNLRDPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVLWELLTGEEPYADLHYGVIIGGIVSNTLRPPVPDSCDLEWKSLMEQCWATEPSERPSFTQIAVR

Gene3D: G3DSA:1.10.510.10
6-181 no description

NGSLRTALLKNAKSLDRRKRLIIAMDTAFGMEYLHNKNIVHFDLKSDNLLVNLRDPQRPICKVGDLGLSKVKCQTLISGGVRGTLPWMAPELLNGSSSLVSEKVDVFSFGIVLWELLTGEEPYADLHYGVIIGGIVSNTLRPPVPDSCDLEWKSLMEQCWATEPSERPSFTQIAVR

FPrintScan: PR00109
IPR001245
38-56 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

YLHNKNIVHFDLKSDNLLV

PatternScan: PS00108
IPR008271
44-56 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHFDLKSDNLLV

FPrintScan: PR00109
IPR001245
109-131 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

VDVFSFGIVLWELLTGEEPYADL

FPrintScan: PR00109
IPR001245
153-175 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

CDLEWKSLMEQCWATEPSERPSF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox