PRGDB00188149 (Bdi.6206)

From PRG Wiki
Jump to: navigation, search
Bdi.6206
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 270420771 (GT801714)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Brachypodium distachyon

Comment?

CCXG11206.b1 CCXG Brachypodium distachyon superpool Brachypodium distachyon cDNA clone CCXG11206 5', mRNA sequence

DNA Sequence

CATTCACTTACGAAGAGCTGGTGAGGGCAACTGATGGATTCTCCGATGCCAATCTCCTTGGACAAGGTGGTTTTGGTTATGTTCACAAGGGTGTGCTGCCTAATGGTAAAGAGATTGCTGTGAAGCAATTGAAACTTGGAAGTGGCCAGGGAGAGCGCGAGTTCCAGGCGGAGGTTGAAATTATCAGCCGAGTTCATCACAAACATCTAGTGTCTTTGGTTGGTTACTGCATTTCTGGGGGCAAGAGGTTGCTTGTCTATGAGTTTGTGACCAATAACACATTGGAATTCCACTTACACGGAAAAGGTCGACCTGTGATGGAGTGGCCTATAAGACTAAGGATTGCTCTAGGTGCTGCTAAGGGCTTGGCATATATTCATGAAGACTGCCATCCCAAGATCATACATCGTGATATAAAGTCATCAAACATTCCTCTTGATTTTAAGTTTGAAGCTAAGGTTGCGGATTTTGGACTTGCAAAGTTCACTTCTGATAACAATACCCATGTTTCTACAAGAGTTATGGGGACTTTTGGGTATCTAGCACCAGAATATGCGTCTTCTGGCAAGCTCACTGAAAAGTCAGATGTCTTTTCCTTTGGAGTAATGCTTCTTGAGCTAATAACTGGGCGCAGGCCTGTTGATTCAGCCCAAACATATATGGATGACAGCTTGGTTGACTGGGCAAGACCTTTATTGATGCGAGCACTTGAGGATGGTAACTATGATGAGTTAGTGATGCTCGTTTGGGAAAGATTTCAATCCCAATG


Protein sequences

Name Description Sequence
Bdi.6206 translated coding region predicted by ESTScan from UniGene Bdi.6206

XFTYEELVRATDGFSDANLLGQGGFGYVHKGVLPNGKEIAVKQLKLGSGQGEREFQAEVEIISRVHHKHLVSLVGYCISGGKRLLVYEFVTNNTLEFHLHGKGRPVMEWPIRLRIALGAAKGLAYIHEDCHPKIIHRDIKSSNIPLDFKFEAKVADFGLAKFTSDNNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPVDSAQTYMDDSLVDWARPLLMRALEDGNYDELVMLVWERFQSQX

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
2-75 no description

FTYEELVRATDGFSDANLLGQGGFGYVHKGVLPNGKEIAVKQLKLGSGQGEREFQAEVEIISRVHHKHLVSLVG

HMMPanther: PTHR24420:SF822
2-246 SUBFAMILY NOT NAMED

FTYEELVRATDGFSDANLLGQGGFGYVHKGVLPNGKEIAVKQLKLGSGQGEREFQAEVEIISRVHHKHLVSLVGYCISGGKRLLVYEFVTNNTLEFHLHGKGRPVMEWPIRLRIALGAAKGLAYIHEDCHPKIIHRDIKSSNIPLDFKFEAKVADFGLAKFTSDNNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPVDSAQTYMDDSLVDWARPLLMRALEDGNYDELV

HMMPanther: PTHR24420
2-246 FAMILY NOT NAMED,FAMILY NOT NAMED

FTYEELVRATDGFSDANLLGQGGFGYVHKGVLPNGKEIAVKQLKLGSGQGEREFQAEVEIISRVHHKHLVSLVGYCISGGKRLLVYEFVTNNTLEFHLHGKGRPVMEWPIRLRIALGAAKGLAYIHEDCHPKIIHRDIKSSNIPLDFKFEAKVADFGLAKFTSDNNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPVDSAQTYMDDSLVDWARPLLMRALEDGNYDELV

superfamily: SSF56112
IPR011009
3-252 Protein kinase-like (PK-like)
Protein kinase-like domain

TYEELVRATDGFSDANLLGQGGFGYVHKGVLPNGKEIAVKQLKLGSGQGEREFQAEVEIISRVHHKHLVSLVGYCISGGKRLLVYEFVTNNTLEFHLHGKGRPVMEWPIRLRIALGAAKGLAYIHEDCHPKIIHRDIKSSNIPLDFKFEAKVADFGLAKFTSDNNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPVDSAQTYMDDSLVDWARPLLMRALEDGNYDELVMLVWER

HMMSmart: SM00219
IPR020635
14-253 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSDANLLGQGGFGYVHKGVLPNGKEIAVKQLKLGSGQGEREFQAEVEIISRVHHKHLVSLVGYCISGGKRLLVYEFVTNNTLEFHLHGKGRPVMEWPIRLRIALGAAKGLAYIHEDCHPKIIHRDIKSSNIPLDFKFEAKVADFGLAKFTSDNNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPVDSAQTYMDDSLVDWARPLLMRALEDGNYDELVMLVWERF

ProfileScan: PS50011
IPR000719
14-257 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDANLLGQGGFGYVHKGVLPNGKEIAVKQLKLGSGQGEREFQAEVEIISRVHHKHLVSLVGYCISGGKRLLVYEFVTNNTLEFHLHGKGRPVMEWPIRLRIALGAAKGLAYIHEDCHPKIIHRDIKSSNIPLDFKFEAKVADFGLAKFTSDNNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPVDSAQTYMDDSLVDWARPLLMRALEDGNYDELVMLVWERFQSQX

HMMSmart: SM00220
IPR002290
14-246 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSDANLLGQGGFGYVHKGVLPNGKEIAVKQLKLGSGQGEREFQAEVEIISRVHHKHLVSLVGYCISGGKRLLVYEFVTNNTLEFHLHGKGRPVMEWPIRLRIALGAAKGLAYIHEDCHPKIIHRDIKSSNIPLDFKFEAKVADFGLAKFTSDNNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPVDSAQTYMDDSLVDWARPLLMRALEDGNYDELV

HMMPfam: PF07714
IPR001245
19-218 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

LLGQGGFGYVHKGVLPNGKEIAVKQLKLGSGQGEREFQAEVEIISRVHHKHLVSLVGYCISGGKRLLVYEFVTNNTLEFHLHGKGRPVMEWPIRLRIALGAAKGLAYIHEDCHPKIIHRDIKSSNIPLDFKFEAKVADFGLAKFTSDNNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPVDSAQ

PatternScan: PS00107
IPR017441
20-42 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGYVHKGVLPNGKEIAVK

Gene3D: G3DSA:1.10.510.10
76-216 no description

YCISGGKRLLVYEFVTNNTLEFHLHGKGRPVMEWPIRLRIALGAAKGLAYIHEDCHPKIIHRDIKSSNIPLDFKFEAKVADFGLAKFTSDNNTHVSTRVMGTFGYLAPEYASSGKLTEKSDVFSFGVMLLELITGRRPVDS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox