PRGDB00188151 (Bdi.10404)

From PRG Wiki
Jump to: navigation, search
Bdi.10404
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 270466015 (GT850189)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Brachypodium distachyon

Comment?

CCYP7761.g1 CCYP Brachypodium distachyon leaf + leaf drought Brachypodium distachyon cDNA clone CCYP7761 3', mRNA sequence

DNA Sequence

GTGCTGAGATATATCTCGGTCAGAAGCTTTCCGCAATAACTAATCGCTGTAGTTGCTTTAGTGGTGACAAGAGCTGGGAGAACGATGGTCGTTTGCTTGGATCATTGTCCCAACACGATAATATTATGCTAGCCACCACTGGGTCGACTTCTTTGGGAATGTCTAGTCGTCTGTTCTGAAACCCAACTGCTCCCACGACCTGCATTGGATTCAGACCGCTCCAGGGTACACGCATAGTTGCTAATTCCCATAGGATTACTCCAAAACTGTAGACATCACACATCTCGTTGGCTGGCTCATTCCGCAGGACCTCTGGTGCCATCCACTCTGGTGTTCCAGCTGTGGACTTAGAGGAAAGGAAAGTGTGATGCTTCAATCTTGACATCCCAAAATCTTAACAACCCAATTTTTATCCACTAAAAGATTTGGGGATTTCAAATCACGATGTACAATAGTAGGATGGCTAGCATGTAAGTAATTCATGCCTTTTGCCACATCAAGTGCCATTTTTAGCCTTCGTGTTTCATCAACTTTGCTATTTGGACGATGCAATAGGCGAAATAGGCTCCCTCTTGGGAGGTATTCAGTTAATATAGACAGATTTGGAGGTTGCGTCACATATCCCAGGAAGAGAACTACATTGGGATGTCTTAGCCTTGACATGATCCTCACTTCACATTTGAATTGCTCTAGTGCAACACCTGATAGATCCTGGTCAAGAAATTTCTTCACGC


Protein sequences

Name Description Sequence
Bdi.10404 translated coding region predicted by ESTScan from UniGene Bdi.10404

XVKKFLDQDLSGVALEQFKCEVRIMSRLRHPNVVLFLGYVTQPPNLSILTEYLPRGSLFRLLHRPNSKVDETRRLKMALDVAKGMNYLHASHPTIVHRDLKSPNLLVDKNWVVXDFGMSRLKHHTFLSSKSTAGTPEWMAPEVLRNEPANEMCDVYSFGVILWELATMRVPWSGLNPMQVVGAVGFQNRRLDIPKEVDPVVASIILSCWDNDPSKRPSFSQLLSPLKQLQRLVIAESFXPRYISAX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-233 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XVKKFLDQDLSGVALEQFKCEVRIMSRLRHPNVVLFLGYVTQPPNLSILTEYLPRGSLFRLLHRPNSKVDETRRLKMALDVAKGMNYLHASHPTIVHRDLKSPNLLVDKNWVVXDFGMSRLKHHTFLSSKSTAGTPEWMAPEVLRNEPANEMCDVYSFGVILWELATMRVPWSGLNPMQVVGAVGFQNRRLDIPKEVDPVVASIILSCWDNDPSKRPSFSQLLSPLKQLQRLV

HMMSmart: SM00220
IPR002290
1-232 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XVKKFLDQDLSGVALEQFKCEVRIMSRLRHPNVVLFLGYVTQPPNLSILTEYLPRGSLFRLLHRPNSKVDETRRLKMALDVAKGMNYLHASHPTIVHRDLKSPNLLVDKNWVVXDFGMSRLKHHTFLSSKSTAGTPEWMAPEVLRNEPANEMCDVYSFGVILWELATMRVPWSGLNPMQVVGAVGFQNRRLDIPKEVDPVVASIILSCWDNDPSKRPSFSQLLSPLKQLQRL

HMMPanther: PTHR23257:SF80
2-231 MAP3K DELTA-1 PROTEIN KINASE,MAP3K DELTA-1 PROTEIN KINASE

VKKFLDQDLSGVALEQFKCEVRIMSRLRHPNVVLFLGYVTQPPNLSILTEYLPRGSLFRLLHRPNSKVDETRRLKMALDVAKGMNYLHASHPTIVHRDLKSPNLLVDKNWVVXDFGMSRLKHHTFLSSKSTAGTPEWMAPEVLRNEPANEMCDVYSFGVILWELATMRVPWSGLNPMQVVGAVGFQNRRLDIPKEVDPVVASIILSCWDNDPSKRPSFSQLLSPLKQLQR

Gene3D: G3DSA:3.30.200.20
2-70 no description

VKKFLDQDLSGVALEQFKCEVRIMSRLRHPNVVLFLGYVTQPPNLSILTEYLPRGSLFRLLHRPNSKVD

HMMPanther: PTHR23257
2-231 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

VKKFLDQDLSGVALEQFKCEVRIMSRLRHPNVVLFLGYVTQPPNLSILTEYLPRGSLFRLLHRPNSKVDETRRLKMALDVAKGMNYLHASHPTIVHRDLKSPNLLVDKNWVVXDFGMSRLKHHTFLSSKSTAGTPEWMAPEVLRNEPANEMCDVYSFGVILWELATMRVPWSGLNPMQVVGAVGFQNRRLDIPKEVDPVVASIILSCWDNDPSKRPSFSQLLSPLKQLQR

HMMSmart: SM00219
IPR020635
2-226 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VKKFLDQDLSGVALEQFKCEVRIMSRLRHPNVVLFLGYVTQPPNLSILTEYLPRGSLFRLLHRPNSKVDETRRLKMALDVAKGMNYLHASHPTIVHRDLKSPNLLVDKNWVVXDFGMSRLKHHTFLSSKSTAGTPEWMAPEVLRNEPANEMCDVYSFGVILWELATMRVPWSGLNPMQVVGAVGFQNRRLDIPKEVDPVVASIILSCWDNDPSKRPSFSQLLSPL

HMMPfam: PF07714
IPR001245
4-224 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

KFLDQDLSGVALEQFKCEVRIMSRLRHPNVVLFLGYVTQPPNLSILTEYLPRGSLFRLLHRPNSKVDETRRLKMALDVAKGMNYLHASHPTIVHRDLKSPNLLVDKNWVVXDFGMSRLKHHTFLSSKSTAGTPEWMAPEVLRNEPANEMCDVYSFGVILWELATMRVPWSGLNPMQVVGAVGFQNRRLDIPKEVDPVVASIILSCWDNDPSKRPSFSQLLS

superfamily: SSF56112
IPR011009
4-226 Protein kinase-like (PK-like)
Protein kinase-like domain

KFLDQDLSGVALEQFKCEVRIMSRLRHPNVVLFLGYVTQPPNLSILTEYLPRGSLFRLLHRPNSKVDETRRLKMALDVAKGMNYLHASHPTIVHRDLKSPNLLVDKNWVVXDFGMSRLKHHTFLSSKSTAGTPEWMAPEVLRNEPANEMCDVYSFGVILWELATMRVPWSGLNPMQVVGAVGFQNRRLDIPKEVDPVVASIILSCWDNDPSKRPSFSQLLSPL

FPrintScan: PR00109
IPR001245
50-63 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

TEYLPRGSLFRLLH

Gene3D: G3DSA:1.10.510.10
71-227 no description

ETRRLKMALDVAKGMNYLHASHPTIVHRDLKSPNLLVDKNWVVXDFGMSRLKHHTFLSSKSTAGTPEWMAPEVLRNEPANEMCDVYSFGVILWELATMRVPWSGLNPMQVVGAVGFQNRRLDIPKEVDPVVASIILSCWDNDPSKRPSFSQLLSPLK

FPrintScan: PR00109
IPR001245
89-107 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

HASHPTIVHRDLKSPNLLV

PatternScan: PS00108
IPR008271
95-107 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKSPNLLV

FPrintScan: PR00109
IPR001245
134-144 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

GTPEWMAPEVL

FPrintScan: PR00109
IPR001245
153-175 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

CDVYSFGVILWELATMRVPWSGL

FPrintScan: PR00109
IPR001245
197-219 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

VDPVVASIILSCWDNDPSKRPSF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox