PRGDB00188153 (Bdi.17498)

From PRG Wiki
Jump to: navigation, search
Bdi.17498
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 270396589 (GT779050)
Gene Class Unknown
Domain Type LRR
Gene Species Brachypodium distachyon

Comment?

CCXF13560.b1 CCXF Brachypodium distachyon abiotic + biotic stress pool Brachypodium distachyon cDNA clone CCXF13560 5', mRNA sequence

DNA Sequence

GGAAGTCCAGTACCTCCACTTCTCTCTAAGCTCAATCCTCCCAATCTGGTTGAAAGAAGCACCTGAAAGAAGAAAGGTCTAAGAAAGGCAGGAGCACCACATGATTCTATCTCCAGACTCCAGTTTCCTGCGATGCAGCTGACCAGCACTGATCTTGCCCCAAGGGTGCTTCTGTATGCCATCAAGCAAACAGAATCAGATTGAATTGAGCAGTGAATCTGTCCTGaaaaaaaaaaaaCAAATTGGAAATGGTTTCGGAAAGCATGAAGGTACTAGCTTTTGGGTTAGTTTTATTGGGGTGCCTGCAACCTTTTGCAGCTATTGACCTCCAAGTCATAGCACTGAATGAAATGAGGACGATGCTCAATGACAGCCGTGGTGTCTTGAATGACTGGAACAGTAATCAAGTTAGTCCCTGCTATTTTGTTAATGTTAGATGCAATCAAGATGGCAACGTCATTGGAATCATATTGAGTTCTTCAGGCTTAAGTGGAGTCTTGTCGCCCAGCATTGCAAAATTAACAGCTTTAGAACAGCTGTTCTTGGATGACAACAGCATAACTGGACGTATTCCACAGGAGTTAGGGAACTTATCAAAGTTAATGACTCTAAAACTTGGAAGAAATCACTTAAATGGCTCGATACCTGAAACATTTGGGCCTTCTTTCAGAACTCCAAAATCTGGATCTAAGCCAAAATCTCTTGAGCGGTAATATTCCGAGCTCTTATCGAATCTTTCACTATGATGACATTACCTAGCAAATATAATCTAC


Protein sequences

Name Description Sequence
Bdi.17498 translated coding region predicted by ESTScan from UniGene Bdi.17498

MVSESMKVLAFGLVLLGCLQPFAAIDLQVIALNEMRTMLNDSRGVLNDWNSNQVSPCYFVNVRCNQDGNVIGIILSSSGLSGVLSPSIAKLTALEQLFLDDNSITGRIPQELGNLSKLMTLKLGRNHLNGSIPETFGPSFRTPKSGSKPKSLER


Domains

Domain Start-End Description Sequence

ProfileScan: PS51257
1-18 PROKAR_LIPOPROTEIN,Prokaryotic membrane lipoprotein lipid attachment site profile.

MVSESMKVLAFGLVLLGC

HMMPanther: PTHR24420
1-137 FAMILY NOT NAMED,FAMILY NOT NAMED

MVSESMKVLAFGLVLLGCLQPFAAIDLQVIALNEMRTMLNDSRGVLNDWNSNQVSPCYFVNVRCNQDGNVIGIILSSSGLSGVLSPSIAKLTALEQLFLDDNSITGRIPQELGNLSKLMTLKLGRNHLNGSIPETFG

HMMPanther: PTHR24420:SF422
1-137 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MVSESMKVLAFGLVLLGCLQPFAAIDLQVIALNEMRTMLNDSRGVLNDWNSNQVSPCYFVNVRCNQDGNVIGIILSSSGLSGVLSPSIAKLTALEQLFLDDNSITGRIPQELGNLSKLMTLKLGRNHLNGSIPETFG

superfamily: SSF52058
22-137 L domain-like,LRR

FAAIDLQVIALNEMRTMLNDSRGVLNDWNSNQVSPCYFVNVRCNQDGNVIGIILSSSGLSGVLSPSIAKLTALEQLFLDDNSITGRIPQELGNLSKLMTLKLGRNHLNGSIPETFG

HMMPfam: PF08263
IPR013210
28-65 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

QVIALNEMRTMLNDSRGVLNDWNSNQVSPCYFVNVRCN

Gene3D: G3DSA:3.80.10.10
29-137 no description

VIALNEMRTMLNDSRGVLNDWNSNQVSPCYFVNVRCNQDGNVIGIILSSSGLSGVLSPSIAKLTALEQLFLDDNSITGRIPQELGNLSKLMTLKLGRNHLNGSIPETFG

Seg: seg
70-85 seg

VIGIILSSSGLSGVLS

HMMPfam: PF00560
IPR001611
94-115 LRR_1
Leucine-rich repeat

LEQLFLDDNSITGRIPQELGNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox