PRGDB00188181 (Cca.6298)

From PRG Wiki
Jump to: navigation, search
Cca.6298
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 315850955 (GT646251)
Gene Class Unknown
Domain Type
Gene Species Coffea canephora

Comment?

CC00-XX-SH3-012-F05-EM.F Coffea canephora SH3 Coffea canephora cDNA clone CC00-XX-SH3-012-F05-EM, mRNA sequence

DNA Sequence

GGATTGTCAAGGCCAGGAATTTGGGTTCTTCCAATTCCGAGGAGATGGAGGAGTATTCCAGCAAGTGCTTGGTGGTGGCCACGGGAGAAACCGCCGATGCATTCATCCCGCACCTTGAAGGTCTCAACACTTACCTGGGCGAGGTCCTCCACAGCACCCGATATAAAAACGGCAAGTCCTATGAAAACAAGAATGTTTTGGTTGTGGGGTCTGGAAATTCTGGTATGGAAATTGCATTTGATCTATCAAACTACGGTGCGAAGACCTCCATCGCCGTCCGTAGCCCGCTTCACATTCTGTCAAGGGGAATGGTATACATAGGACCGGCTTTGTTGAAATATTTTTCTCTGAATACGGTTGACTGGCTGGTGGTGATGCTGAGCAAGCTGTGGTACGGAGGAGACTTGTCCAGGTACGGAATCAAAAGGCCAGAGGAAGGTCCCTTCACCATGAAAATCAAGTACGGCAAGTTCCCCGTCATTGACGTGNGAACCTGTCAGAAAATCAAATCCGGCGAGATTCAGGTACTGCCGGCAGTAGCAAGTCTTGGAGGCAATGATGTGGTGTTTGAGGATGGCAAGTCTTACCCATTTGATGCTATTATTTTTGCAACCGGCTTTAAGAGATCGACGAATAAGTGGCTCCAGGGGGCTGATGATCTCCTGACTGACGACGGATTTGCAAAACCTGCCTTTCCTAACAACTGGAAGGGTACCAAGGGATTGTACTGCGCTGGTTTGGCTAGAAGAGGATGTATGGAGCTGCTCTGGATG


Protein sequences

Name Description Sequence
Cca.6298 translated coding region predicted by ESTScan from UniGene Cca.6298

XIVKARNLGSSNSEEMEEYSSKCLVVATGETADAFIPHLEGLNTYLGEVLHSTRYKNGKSYENKNVLVVGSGNSGMEIAFDLSNYGAKTSIAVRSPLHILSRGMVYIGPALLKYFSLNTVDWLVVMLSKLWYGGDLSRYGIKRPEEGPFTMKIKYGKFPVIDVXTCQKIKSGEIQVLPAVASLGGNDVVFEDGKSYPFDAIIFATGFKRSTNKWLQGADDLLTDDGFAKPAFPNNWKGTKGLYCAGLARRGCMELLWM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23023
2-251 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

IVKARNLGSSNSEEMEEYSSKCLVVATGETADAFIPHLEGLNTYLGEVLHSTRYKNGKSYENKNVLVVGSGNSGMEIAFDLSNYGAKTSIAVRSPLHILSRGMVYIGPALLKYFSLNTVDWLVVMLSKLWYGGDLSRYGIKRPEEGPFTMKIKYGKFPVIDVXTCQKIKSGEIQVLPAVASLGGNDVVFEDGKSYPFDAIIFATGFKRSTNKWLQGADDLLTDDGFAKPAFPNNWKGTKGLYCAGLARRG

HMMPanther: PTHR23023:SF5
2-251 MONOOXYGENASE,MONOOXYGENASE

IVKARNLGSSNSEEMEEYSSKCLVVATGETADAFIPHLEGLNTYLGEVLHSTRYKNGKSYENKNVLVVGSGNSGMEIAFDLSNYGAKTSIAVRSPLHILSRGMVYIGPALLKYFSLNTVDWLVVMLSKLWYGGDLSRYGIKRPEEGPFTMKIKYGKFPVIDVXTCQKIKSGEIQVLPAVASLGGNDVVFEDGKSYPFDAIIFATGFKRSTNKWLQGADDLLTDDGFAKPAFPNNWKGTKGLYCAGLARRG

Seg: seg
10-21 seg

SSNSEEMEEYSS

HMMPfam: PF00743
IPR020946
23-208 FMO-like
Flavin monooxygenase-like

CLVVATGETADAFIPHLEGLNTYLGEVLHSTRYKNGKSYENKNVLVVGSGNSGMEIAFDLSNYGAKTSIAVRSPLHILSRGMVYIGPALLKYFSLNTVDWLVVMLSKLWYGGDLSRYGIKRPEEGPFTMKIKYGKFPVIDVXTCQKIKSGEIQVLPAVASLGGNDVVFEDGKSYPFDAIIFATGFK

superfamily: SSF51905
33-204 FAD/NAD(P)-binding domain

DAFIPHLEGLNTYLGEVLHSTRYKNGKSYENKNVLVVGSGNSGMEIAFDLSNYGAKTSIAVRSPLHILSRGMVYIGPALLKYFSLNTVDWLVVMLSKLWYGGDLSRYGIKRPEEGPFTMKIKYGKFPVIDVXTCQKIKSGEIQVLPAVASLGGNDVVFEDGKSYPFDAIIFA

Gene3D: G3DSA:3.50.50.60
171-204 no description

SGEIQVLPAVASLGGNDVVFEDGKSYPFDAIIFA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox