PRGDB00188182 (Cca.6912)

From PRG Wiki
Jump to: navigation, search
Cca.6912
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 315864471 (GT648623)
Gene Class Unknown
Domain Type LRR
Gene Species Coffea canephora

Comment?

CC00-XX-SH3-077-E01-EM.F Coffea canephora SH3 Coffea canephora cDNA clone CC00-XX-SH3-077-E01-EM, mRNA sequence

DNA Sequence

ACTGTCCCAAATTGATCCCTCATAGTTTCAAAGGATTTGCTTTTGCCACCAGCTTAAGAGAATTGAGCATCAACATTCCCTTCTCCTCAGATGACTCCTCAGTCGATGATTTTGATTGGTCTGGTTTAAGATCTGCATCAACACTCCGTGAGCTTAGCTTAGAAGGGCTGCCTCACACGGAGTCCCTGCCACACCAGCTTCAATACTTGGCTACCCTCACTTCACTAAGTCTGGCCAACTTTGGAGGAATAGAAGTGCTACCGGATTGGATTGGAAACCTTGTGTCCCTTGAAACCCTAGAGCTATGGGATTGCGAAAACCTTCGGTCTTTACCATCCGAGGCTGCCATGAGACGACTCACAAAGTTAACTCGTGTCGACGTCTTTGATTGTCCTCTACTAAGACAACGATACACTCCCCAAAGAGGCATCTACTTGGAGGAGGAGATTTCAAGTGATCCGACAAGTGGTGACTACGAACAAGAATGCAATAATGGTGCTCAAAAATCAGTTTCATGTTGTTTCCCATCATTGCTGAAGAAGGAGAAACCAGGAGAGTCTTAGAAAGCAGACCTCATGTTGTTGGACAAAGACACCACCCTTTGCTGTTGCATTTCTTACAAGATTGCCAGGGGGCAGAAGTTATTTTCACTGACTAGACAGGTTTGAAGATGAAGTTAGTAATCAATGATGAGAATCTTGCACATCAGATAGCGCTAGCTTTGAT


Protein sequences

Name Description Sequence
Cca.6912 translated coding region predicted by ESTScan from UniGene Cca.6912

XCPKLIPHSFKGFAFATSLRELSINIPFSSDDSSVDDFDWSGLRSASTLRELSLEGLPHTESLPHQLQYLATLTSLSLANFGGIEVLPDWIGNLVSLETLELWDCENLRSLPSEAAMRRLTKLTRVDVFDCPLLRQRYTPQRGIYLEEEISSDPTSGDYEQECNNGAQKSVSCCFPSLLKKEKPGEXLESRPHVVGQRHHPLLLHFLQDCQGAEVIFTDXTGLKMKLVINDENLAHQIALALX

Domains

Domain Start-End Description Sequence

Seg: seg
29-41 seg

SSDDSSVDDFDWS

superfamily: SSF52058
32-134 L domain-like,LRR

DSSVDDFDWSGLRSASTLRELSLEGLPHTESLPHQLQYLATLTSLSLANFGGIEVLPDWIGNLVSLETLELWDCENLRSLPSEAAMRRLTKLTRVDVFDCPLL

Gene3D: G3DSA:3.80.10.10
35-134 no description

VDDFDWSGLRSASTLRELSLEGLPHTESLPHQLQYLATLTSLSLANFGGIEVLPDWIGNLVSLETLELWDCENLRSLPSEAAMRRLTKLTRVDVFDCPLL

Seg: seg
178-189 seg

LLKKEKPGEXLE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox