PRGDB00188186 (Cca.14846)

From PRG Wiki
Jump to: navigation, search
Cca.14846
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 315853677 (GT650449)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Coffea canephora

Comment?

CC00-XX-SH3-049-H06-EM.F Coffea canephora SH3 Coffea canephora cDNA clone CC00-XX-SH3-049-H06-EM, mRNA sequence

DNA Sequence

AAGATCATAGCAGGAATAGCTTTGAGGACTTCTTTATCTTCATGAAGATTCTCGGCTTAGGATTATACATCGCGATCTTAAAGCCAGCAATATATTACTGGACAGAGATATGAATCCCAAGATTGCAGATTTTGGCATGGCAAGGCTTTTTGGTGCTGATCAATCTGCGGCTACTACAAAAACAATTGCCGGAACATATGGCTACATGTCTCCTGAATATGCAATGCATGGCCATTTCTCAACAAAGTCAGACGTGTTTAGTTTTGGTGTTCTGGTTCTGGAAATTGTAACCGGCAAGAAAAATAGCAGCTTCTACCAGTCAGATGGTGCGCAAGATCTTCTAAGCCATTGTTGGAAAAATTGGAGGGATGGGACGCCATTAGCATTGCTGGATCCAATTCTTGGAAACTCCTCTGCCAGAAACGAAGTGATTCAGAGCATCCATATTGGCTTACTATGTGTTCAAGAAGATGTTGATGAGAGGCCTAACATGGCCTCGGTGGTTCTTATGCTCAGCAGTCGTTCTGCCACCATGCCCACTGCAGATCAACCTGCATTTTTTGCTCGCAGTAAAACAGAGAGCTTTCCGAGAGAGTTTCAGTTTGATGCATCCACATCCAACTCAATGCCAGCTTAAGTCAATGAAACAACCGTTACGGAATTATATTCCAGATAGAGCAAGTCAT


Protein sequences

Name Description Sequence
Cca.14846 translated coding region predicted by ESTScan from UniGene Cca.14846

KIIAGIALRLLYLHEDSRLRIIHRDLKASNILLDRDMNPKIADFGMARLFGADQSAATTKTIAGTYGYMSPEYAMHGHFSTKSDVFSFGVLVLEIVTGKKNSSFYQSDGAQDLLSHCWKNWRDGTPLALLDPILGNSSARNEVIQSIHIGLLCVQEDVDERPNMASVVLMLSSRSATMPTADQPAFFARSKTESFPREFQFDASTSNSMPA

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:1.10.510.10
1-206 no description

KIIAGIALRLLYLHEDSRLRIIHRDLKASNILLDRDMNPKIADFGMARLFGADQSAATTKTIAGTYGYMSPEYAMHGHFSTKSDVFSFGVLVLEIVTGKKNSSFYQSDGAQDLLSHCWKNWRDGTPLALLDPILGNSSARNEVIQSIHIGLLCVQEDVDERPNMASVVLMLSSRSATMPTADQPAFFARSKTESFPREFQFDASTS

ProfileScan: PS50011
IPR000719
1-186 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KIIAGIALRLLYLHEDSRLRIIHRDLKASNILLDRDMNPKIADFGMARLFGADQSAATTKTIAGTYGYMSPEYAMHGHFSTKSDVFSFGVLVLEIVTGKKNSSFYQSDGAQDLLSHCWKNWRDGTPLALLDPILGNSSARNEVIQSIHIGLLCVQEDVDERPNMASVVLMLSSRSATMPTADQPAF

superfamily: SSF56112
IPR011009
1-179 Protein kinase-like (PK-like)
Protein kinase-like domain

KIIAGIALRLLYLHEDSRLRIIHRDLKASNILLDRDMNPKIADFGMARLFGADQSAATTKTIAGTYGYMSPEYAMHGHFSTKSDVFSFGVLVLEIVTGKKNSSFYQSDGAQDLLSHCWKNWRDGTPLALLDPILGNSSARNEVIQSIHIGLLCVQEDVDERPNMASVVLMLSSRSATMP

HMMPanther: PTHR24420
1-209 FAMILY NOT NAMED,FAMILY NOT NAMED

KIIAGIALRLLYLHEDSRLRIIHRDLKASNILLDRDMNPKIADFGMARLFGADQSAATTKTIAGTYGYMSPEYAMHGHFSTKSDVFSFGVLVLEIVTGKKNSSFYQSDGAQDLLSHCWKNWRDGTPLALLDPILGNSSARNEVIQSIHIGLLCVQEDVDERPNMASVVLMLSSRSATMPTADQPAFFARSKTESFPREFQFDASTSNSM

HMMPanther: PTHR24420:SF430
1-209 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

KIIAGIALRLLYLHEDSRLRIIHRDLKASNILLDRDMNPKIADFGMARLFGADQSAATTKTIAGTYGYMSPEYAMHGHFSTKSDVFSFGVLVLEIVTGKKNSSFYQSDGAQDLLSHCWKNWRDGTPLALLDPILGNSSARNEVIQSIHIGLLCVQEDVDERPNMASVVLMLSSRSATMPTADQPAFFARSKTESFPREFQFDASTSNSM

HMMSmart: SM00219
IPR020635
1-171 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

KIIAGIALRLLYLHEDSRLRIIHRDLKASNILLDRDMNPKIADFGMARLFGADQSAATTKTIAGTYGYMSPEYAMHGHFSTKSDVFSFGVLVLEIVTGKKNSSFYQSDGAQDLLSHCWKNWRDGTPLALLDPILGNSSARNEVIQSIHIGLLCVQEDVDERPNMASVVLML

HMMSmart: SM00220
IPR002290
1-134 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

KIIAGIALRLLYLHEDSRLRIIHRDLKASNILLDRDMNPKIADFGMARLFGADQSAATTKTIAGTYGYMSPEYAMHGHFSTKSDVFSFGVLVLEIVTGKKNSSFYQSDGAQDLLSHCWKNWRDGTPLALLDPIL

HMMPfam: PF00069
IPR000719
2-107 Pkinase,Ser-thr
Protein kinase, catalytic domain

IIAGIALRLLYLHEDSRLRIIHRDLKASNILLDRDMNPKIADFGMARLFGADQSAATTKTIAGTYGYMSPEYAMHGHFSTKSDVFSFGVLVLEIVTGKKNSSFYQS

PatternScan: PS00108
IPR008271
21-33 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox