PRGDB00188188 (Cca.15170)

From PRG Wiki
Jump to: navigation, search
Cca.15170
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 315891000 (GT651496)
Gene Class Unknown
Domain Type LRR
Gene Species Coffea canephora

Comment?

CC00-XX-SH3-067-D09-EM.F Coffea canephora SH3 Coffea canephora cDNA clone CC00-XX-SH3-067-D09-EM, mRNA sequence

DNA Sequence

TTAAAAGAATGTCCCAAATTGATCCCTCACAGGTTCAATGGATTTGCTTTTGCCGCCAGCTTACGATATTTGTCGATCGGTCCCTTCTCCTCAGATGACTTCTCAATGGATGATTTTGATTGGTCTGGCTTGGAAAATGCATCAACACTCCGTGAGCTTCAATTACGAGGCTTGCCTCACACGGAGTCCCTGCCACACCAGCTTCAATACTTGACTACCCTCACTTCACTAACTCTTCACAACTTTGGAGGAATAAGAGTGCTACCGGATTGGATTGGAAACCTTGTGTCCCTTGAAACCCTAGAACTAGAGTCTTGCGAAAACCTTCGGTCTTTACCATCCGAGGCCACCATGAGACGACTCACAAAGTTAACTCGTGTTAGAGTTTATCGGTGTCCTCTATTAAAACAATGATACACTCCCCAAAGAGGCATCTACTACTTGGAGGAGGAGATTTCAAGTGATCCGTGACCGAACAAGAAGGCAATAATGGTGCTCAAACATTAGTTTCATGTTGATTCCCATCCTTGCTGAAGAAGGAGAAACCAGAAGAGTCTTAGAAAGCAGACCTCATGTTGTTCGACAAAGACACCACCCTTTGCTGTTGCATTTCTTACAAGAGTGCCAGGGGGGCAGAAGTTATTTTCACTGACTAGCTAGGTTTGAAGATGAAGTTAGTAATCAATGATGAGAATTTTGCACATCAGAGAGTGCTAGCTTTGACGGAGGCTTCACCAATAGTGAGCTGGATTACTGTATT


Protein sequences

Name Description Sequence
Cca.15170 translated coding region predicted by ESTScan from UniGene Cca.15170

LKECPKLIPHRFNGFAFAASLRYLSIGPFSSDDFSMDDFDWSGLENASTLRELQLRGLPHTESLPHQLQYLTTLTSLTLHNFGGIRVLPDWIGNLVSLETLELESCENLRSLPSEATMRRLTKLTRVRVYRCPLLKQ

Domains

Domain Start-End Description Sequence

Seg: seg
29-40 seg

FSSDDFSMDDFD

superfamily: SSF52058
35-135 L domain-like,LRR

SMDDFDWSGLENASTLRELQLRGLPHTESLPHQLQYLTTLTSLTLHNFGGIRVLPDWIGNLVSLETLELESCENLRSLPSEATMRRLTKLTRVRVYRCPLL

Gene3D: G3DSA:3.80.10.10
42-134 no description

SGLENASTLRELQLRGLPHTESLPHQLQYLTTLTSLTLHNFGGIRVLPDWIGNLVSLETLELESCENLRSLPSEATMRRLTKLTRVRVYRCPL

Seg: seg
71-79 seg

LTTLTSLTL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox