PRGDB00188301 (Gma.7801)

From PRG Wiki
Jump to: navigation, search
Gma.7801
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 336390562 (HQ651811)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Glycine max

Comment?

Glycine max serine threonine tyrosine kinase mRNA, complete cds

DNA Sequence

GGAGAAGACAAGTGACAAGAGTGTGAACTGCAAAGGGCTTCTCCAGCCTAGTTTGTTCTCAGATCTTCTTCTTCCATGGACCAGTACGAGAAGGTGGAGAAGATAGGCGAGGGAACATACGGCGTCGTTTACAAGGCTCGCGACCGCGCCACCAATGAGACAATCGCTCTGAAGAAGATTCGCCTCGAGCAGGAGGACGAAGGCGTTCCCAGCACCGCCATTCGCGAGATTTCTCTTCTCAAAGAGATGCAGCATAGGAACATTGTTAGGTTGCAGGATGTAGTGCACAGTGAGAAGCGATTGTATCTGGTTTTTGAGTATCTGGACTTGGATCTAAAAAAACACATGGATTCATCTCCAGAGTTTGTGAAAGATCCGCGGCAAGTAAAGATGTTCCTTTATCAAATTCTCTGTGGCATTGCTTACTGTCATTCACATAGAGTTCTTCATCGAGACTTGAAACCACAGAATTTGTTGATAGATCGCCGTACTAATTCACTGAAGCTTGCAGATTTTGGATTGGCTAGGGCATTTGGCATTCCTGTCAGGACCTTTACACATGAGGTGGTGACATTATGGTACAGAGCTCCAGAAATATTGCTTGGATCTCGTCATTATTCTACGCCAGTTGATGTTTGGTCAGTGGGATGCATATTTGCAGAGATGGTAAACAGACGACCTCTATTCCCTGGGGACTCTGAGATTGATGAATTATTTAAAATATTCAGAATCTTGGGTACCCCAAATGAAGACACATGGCCTGGAGTAACTTCATTGCCTGATTTCAAATCAACATTTCCCAAATGGCCATCCAAGGACTTAGCAAATGTGGTTCCAAATCTTGATGCAGCTGGTCTTAATCTTCTTTCTAGTATGCTTTGCTTGGATCCCAGCAAAAGAATTACCGCCAGGAGCGCTGTGGAGCATGAATACTTCAAAGACATTAAATTTGTGCCCTGATTCCATATCTTGATGGCAAACGTGTTTATAGTAATATTGTGCAGAATTTATGGGTTTTGACTCTTCGAGAAATGCGTGTTGTCTTTTGCTACTTTTTTTGTGACTTGGGGGTTGGGACTGAGTCATACTTCTATTTTTTGGTCCTTATAGAATGTTTCAGATTCAACTTGAGTGATTGATTATATTGCATATTACTTTTTCTACTACTaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Gma.7801 translated coding region predicted by ESTScan from UniGene Gma.7801

XEKTSDKSVNCKGLLQPXFVLRSSSSMDQYEKVEKIGEGTYGVVYKARDRATNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHRNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSSPEFVKDPRQVKMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNRRPLFPGDSEIDELFKIFRILGTPNEDTWPGVTSLPDFKSTFPKWPSKDLANVVPNLDAAGLNLLSSMLCLDPSKRITARSAVEHEYFKDIKFVP

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
16-320 Protein kinase-like (PK-like)
Protein kinase-like domain

QPXFVLRSSSSMDQYEKVEKIGEGTYGVVYKARDRATNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHRNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSSPEFVKDPRQVKMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNRRPLFPGDSEIDELFKIFRILGTPNEDTWPGVTSLPDFKSTFPKWPSKDLANVVPNLDAAGLNLLSSMLCLDPSKRITARSAVEHEYFKDIKFVP

HMMPanther: PTHR24056:SF109
19-317 SUBFAMILY NOT NAMED,SHAGGY-RELATED PROTEIN KINASE

FVLRSSSSMDQYEKVEKIGEGTYGVVYKARDRATNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHRNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSSPEFVKDPRQVKMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNRRPLFPGDSEIDELFKIFRILGTPNEDTWPGVTSLPDFKSTFPKWPSKDLANVVPNLDAAGLNLLSSMLCLDPSKRITARSAVEHEYFKDIK

HMMPanther: PTHR24056
19-317 FAMILY NOT NAMED,CELL DIVISION PROTEIN KINASE

FVLRSSSSMDQYEKVEKIGEGTYGVVYKARDRATNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHRNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSSPEFVKDPRQVKMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNRRPLFPGDSEIDELFKIFRILGTPNEDTWPGVTSLPDFKSTFPKWPSKDLANVVPNLDAAGLNLLSSMLCLDPSKRITARSAVEHEYFKDIK

Gene3D: G3DSA:3.30.200.20
26-104 no description

SMDQYEKVEKIGEGTYGVVYKARDRATNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHRNIVRLQDVVHSEKRLYL

HMMSmart: SM00219
IPR020635
30-313 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEKVEKIGEGTYGVVYKARDRATNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHRNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSSPEFVKDPRQVKMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNRRPLFPGDSEIDELFKIFRILGTPNEDTWPGVTSLPDFKSTFPKWPSKDLANVVPNLDAAGLNLLSSMLCLDPSKRITARSAVEHEYF

ProfileScan: PS50011
IPR000719
30-313 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEKVEKIGEGTYGVVYKARDRATNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHRNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSSPEFVKDPRQVKMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNRRPLFPGDSEIDELFKIFRILGTPNEDTWPGVTSLPDFKSTFPKWPSKDLANVVPNLDAAGLNLLSSMLCLDPSKRITARSAVEHEYF

HMMSmart: SM00220
IPR002290
30-313 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEKVEKIGEGTYGVVYKARDRATNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHRNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSSPEFVKDPRQVKMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNRRPLFPGDSEIDELFKIFRILGTPNEDTWPGVTSLPDFKSTFPKWPSKDLANVVPNLDAAGLNLLSSMLCLDPSKRITARSAVEHEYF

HMMPfam: PF00069
IPR000719
30-313 Pkinase,Ser-thr
Protein kinase, catalytic domain

YEKVEKIGEGTYGVVYKARDRATNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHRNIVRLQDVVHSEKRLYLVFEYLDLDLKKHMDSSPEFVKDPRQVKMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNRRPLFPGDSEIDELFKIFRILGTPNEDTWPGVTSLPDFKSTFPKWPSKDLANVVPNLDAAGLNLLSSMLCLDPSKRITARSAVEHEYF

PatternScan: PS00107
IPR017441
36-59 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGTYGVVYKARDRATNETIALK

Gene3D: G3DSA:1.10.510.10
105-314 no description

VFEYLDLDLKKHMDSSPEFVKDPRQVKMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNRRPLFPGDSEIDELFKIFRILGTPNEDTWPGVTSLPDFKSTFPKWPSKDLANVVPNLDAAGLNLLSSMLCLDPSKRITARSAVEHEYFK

PatternScan: PS00108
IPR008271
149-161 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDLKPQNLLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox