PRGDB00189989 (Lsa.53)

From PRG Wiki
Jump to: navigation, search
Lsa.53
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 329681078 (JI583584)
Gene Class Unknown
Domain Type
Gene Species Lactuca sativa

Comment?

TSA: Lactuca sativa Letassy_X1_21310 mRNA sequence

DNA Sequence

TGGTAGTTGATATAGATTTGAATTTGGTCACACATAATTTTTCAACTCAAAGGCATATTCATGGATGTAATGAGAAAACAAGAATTTACAAATGAAGATGATTGAAGTAAAGTAGGATATTTAAGTGTTCTTTACAAAGGTATTAATTTGAAGCAAATCAACATTGAAGAAGAGGAGTAGCATGCAGTAGTTACATACATAAACACAATTGACACTGACAGTGACACTGACAGAATTCAAATCCTTGATGGAATCATGGGAATGTTGTTCTGTAGATATGCACAAGCAGCAGCCACTCCACTCCCCAGCTTCACCGGGTATCCCACATCCTTGAGCACCATCTCCACCCCCGCAAGACACCCCAGCAGTTGCAAGTCATTAACATGGCCAAGATGTCCTATTCTGAAGACTTTTCCAGCTACTTTGTTAAGGCCAAGACCCAAGCTTAAGTTGTATCTTTTCCATCCCCTTCTAACAATTTCAGAGCTATCAATATATGGAGGAACAACCACAGCTGTGACTGTGTCACTGAACCATTCCTCCTTTTGGGTGCAGTTTTTCAACCCCCATGCTTCAACAGCCAGCCTTGTGGCAGTGCCAAGACGATTGTGCCTTGCAATAACATTATCCAAGCCTTCTTCAAAGATGAGATCAAGGGCAGCTTTTAGGCCATAGAGAAGCTGAATGGAAGGAGTGTAGGGCCAATAAGTCCCCATTTTGTAGAATTTCAAGTAATCTTTCCAGTCAAAGAAAACTCGAAGTGATTTTGCAGTTTGAGAGGCCTCGATGGCTTTAGGGCTCGCACACACGATTCCCATACCGGTGGGAAGGGAAAGTGCTTTCTGAGAACCGGTTAAAGCCACATCTACACCCCATTCATCCATGCGGAAATCCAAAGCGCATATTGATGACACCCCATCAACTAGAAACAGGGCCGGGTGCTGGTAGTGATCAAGTATTTTCCTTACGGAAGCCAAGTTGTTTGTAACTCCGGTGGCAGTCTCATTGTGAACAATGCAGACAGCCTTAATAGTATGCGCAGTATCTGCAGCCAGTTTTGATGCTAAAACTTCCAAGTTAGCACCCGCACCCCATTCACTTTCCACCACATCAACATTGAACCCAAGTCGTTGCTGTTGATCCACCCAAAGCAAACTGAATTGTCCAATCACAAATGACACAATTCGGTCTCCAGGAGACAAGGTGTTTGTAAGTGCACTTTCCCATGCACCCGTACCTGTAGTTGGGATGAGAAAAGGGGTCCCCGAAGTGGTTTTGAAAATCTTCTTCACATCTTCAAGTAAAATTTTAGTCAAAGCGGGAACTGCTGGAGACCGATAGTCTTCATTGTTTCGGTTCATTGCACGAAGTACTTGATCCGGGATGTTCACGGGTCCCGGAACAAACAAATGATTCCTTCCAGGTGCATAAGTATAGTCCATCTTTTCCTTACCTGATTGCGTAGGATCTCTGTgaaggaggaggaggaggaaggaaaagacacggatgaaaaagccaaaaaggaagggaaTCGGAATTTATAAGAGGGCGGGAGATGATGTGGGTCCCATCAGCAGATAAGAA


Protein sequences

Name Description Sequence
Lsa.53 translated coding region predicted by ESTScan from UniGene Lsa.53

MDYTYAPGRNHLFVPGPVNIPDQVLRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLGFNVDVVESEWGAGANLEVLASKLAADTAHTIKAVCIVHNETATGVTNNLASVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASQTAKSLRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLKAALDLIFEEGLDNVIARHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSSEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGHVNDLQLLGCLAGVEMVLKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
1-401 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDYTYAPGRNHLFVPGPVNIPDQVLRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLGFNVDVVESEWGAGANLEVLASKLAADTAHTIKAVCIVHNETATGVTNNLASVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASQTAKSLRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLKAALDLIFEEGLDNVIARHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSSEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGHVNDLQLLGCLAGVEMVLKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI

HMMPanther: PTHR21152
1-401 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

MDYTYAPGRNHLFVPGPVNIPDQVLRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLGFNVDVVESEWGAGANLEVLASKLAADTAHTIKAVCIVHNETATGVTNNLASVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASQTAKSLRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLKAALDLIFEEGLDNVIARHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSSEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGHVNDLQLLGCLAGVEMVLKDVGYPVKLGSGVAAACAYLQNNIPMIPSRI

superfamily: SSF53383
IPR015424
7-377 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

PGRNHLFVPGPVNIPDQVLRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLGFNVDVVESEWGAGANLEVLASKLAADTAHTIKAVCIVHNETATGVTNNLASVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASQTAKSLRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLKAALDLIFEEGLDNVIARHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSSEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGHVNDLQLLGCLAGVEMVLKDVGYPV

HMMPfam: PF00266
IPR000192
12-323 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

LFVPGPVNIPDQVLRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLGFNVDVVESEWGAGANLEVLASKLAADTAHTIKAVCIVHNETATGVTNNLASVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASQTAKSLRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLKAALDLIFEEGLDNVIARHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSSEIV

Gene3D: G3DSA:3.40.640.10
IPR015421
21-257 no description
Pyridoxal phosphate-dependent transferase, major r

PDQVLRAMNRNNEDYRSPAVPALTKILLEDVKKIFKTTSGTPFLIPTTGTGAWESALTNTLSPGDRIVSFVIGQFSLLWVDQQQRLGFNVDVVESEWGAGANLEVLASKLAADTAHTIKAVCIVHNETATGVTNNLASVRKILDHYQHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGMGIVCASPKAIEASQTAKSLRVFFDWKDYLKFYKMGTYWPYTPSIQLLY

PatternScan: PS00595
IPR020578
192-212 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGMGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
258-383 no description
Pyridoxal phosphate-dependent transferase, major r

GLKAALDLIFEEGLDNVIARHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSSEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGHVNDLQLLGCLAGVEMVLKDVGYPVKLGSGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox