PRGDB00190546 (Lsa.21755)

From PRG Wiki
Jump to: navigation, search
Lsa.21755
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 90500919 (DY962777)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Lactuca sativa

Comment?

CLSM13055.b1_N24.ab1 CLS(LMS) lettuce sativa Lactuca sativa cDNA clone CLSM13055, mRNA sequence

DNA Sequence

ATATTCACAGAAAGACTACTACACTATAACCTTACTTAATCAGCAATATAAAAAACAATGTCTTCTTCCGAGGTAGACCTAGAAAAATGTCGAATTCCACTAGCGGAGATCATTCGGGCCACAAAAAACTTCAGTTCAGAAACTCTGGTCGGGGATGGTGGATTTGGTATGGTCTACAGAGGCCAACTCTCTAACCACTGGAAAAAACAGCTATTAGCCATCAAACGCCTTGATCCTAAAGGTTATCAAGGAACCAAGGAGTTCCATAATGAAGTCAAGTTGGTTTCAAGTTTCAACCATCCAAACATCATCCCTTTCGTTGGCTACTGTGATGATGAAAATGAGAAAATTATAGTTTTCGAGTATGCTACAAACAGAAGCCTTGAGTATCACCTCCAAGACCGAGATAGGAGGAGTCGCCTAACATGGGAACAACGCCTGAAGATATGCTTAGGGGCAGCGTACGGACTAAAGTACCTTCACTCGGGTGTTGGGGAGCACAGCAGAGTAATTCATAGAGATTTGAAGAGTGCAAATATATTGTTAGATGATAATCTGGAAGCCAAAATATGTGATTTTGGTTTGTCAAGATTAAGTCCAAGAAATCAGCAAGATACCCATGTCCGTACAAAAGCTGCTGGTACAAGGTTTTACATGGATCCGAGTTACGTGGAAAGTAGTACGCTCACTAAAGAGTCCGACATATACTCATTTGGAGTCATAATGTTCGAGATATCTAGTGGGATGATGGCTTATCATGCAAGGCGGTTTAAAGATTCTAAGGAACTTTATCTGATCTACCTCGTCCGAAGCTACTATCACGACCAT


Protein sequences

Name Description Sequence
Lsa.21755 translated coding region predicted by ESTScan from UniGene Lsa.21755

MSSSEVDLEKCRIPLAEIIRATKNFSSETLVGDGGFGMVYRGQLSNHWKKQLLAIKRLDPKGYQGTKEFHNEVKLVSSFNHPNIIPFVGYCDDENEKIIVFEYATNRSLEYHLQDRDRRSRLTWEQRLKICLGAAYGLKYLHSGVGEHSRVIHRDLKSANILLDDNLEAKICDFGLSRLSPRNQQDTHVRTKAAGTRFYMDPSYVESSTLTKESDIYSFGVIMFEISSGMMAYHARRFKDSKELYLIYLVRSYYHDH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
12-256 FAMILY NOT NAMED,FAMILY NOT NAMED

RIPLAEIIRATKNFSSETLVGDGGFGMVYRGQLSNHWKKQLLAIKRLDPKGYQGTKEFHNEVKLVSSFNHPNIIPFVGYCDDENEKIIVFEYATNRSLEYHLQDRDRRSRLTWEQRLKICLGAAYGLKYLHSGVGEHSRVIHRDLKSANILLDDNLEAKICDFGLSRLSPRNQQDTHVRTKAAGTRFYMDPSYVESSTLTKESDIYSFGVIMFEISSGMMAYHARRFKDSKELYLIYLVRSYYHD

Gene3D: G3DSA:3.30.200.20
14-89 no description

PLAEIIRATKNFSSETLVGDGGFGMVYRGQLSNHWKKQLLAIKRLDPKGYQGTKEFHNEVKLVSSFNHPNIIPFVG

superfamily: SSF56112
IPR011009
14-240 Protein kinase-like (PK-like)
Protein kinase-like domain

PLAEIIRATKNFSSETLVGDGGFGMVYRGQLSNHWKKQLLAIKRLDPKGYQGTKEFHNEVKLVSSFNHPNIIPFVGYCDDENEKIIVFEYATNRSLEYHLQDRDRRSRLTWEQRLKICLGAAYGLKYLHSGVGEHSRVIHRDLKSANILLDDNLEAKICDFGLSRLSPRNQQDTHVRTKAAGTRFYMDPSYVESSTLTKESDIYSFGVIMFEISSGMMAYHARRFKD

HMMSmart: SM00220
IPR002290
25-254 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSSETLVGDGGFGMVYRGQLSNHWKKQLLAIKRLDPKGYQGTKEFHNEVKLVSSFNHPNIIPFVGYCDDENEKIIVFEYATNRSLEYHLQDRDRRSRLTWEQRLKICLGAAYGLKYLHSGVGEHSRVIHRDLKSANILLDDNLEAKICDFGLSRLSPRNQQDTHVRTKAAGTRFYMDPSYVESSTLTKESDIYSFGVIMFEISSGMMAYHARRFKDSKELYLIYLVRSYY

ProfileScan: PS50011
IPR000719
25-257 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSETLVGDGGFGMVYRGQLSNHWKKQLLAIKRLDPKGYQGTKEFHNEVKLVSSFNHPNIIPFVGYCDDENEKIIVFEYATNRSLEYHLQDRDRRSRLTWEQRLKICLGAAYGLKYLHSGVGEHSRVIHRDLKSANILLDDNLEAKICDFGLSRLSPRNQQDTHVRTKAAGTRFYMDPSYVESSTLTKESDIYSFGVIMFEISSGMMAYHARRFKDSKELYLIYLVRSYYHDH

HMMSmart: SM00219
IPR020635
25-253 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSSETLVGDGGFGMVYRGQLSNHWKKQLLAIKRLDPKGYQGTKEFHNEVKLVSSFNHPNIIPFVGYCDDENEKIIVFEYATNRSLEYHLQDRDRRSRLTWEQRLKICLGAAYGLKYLHSGVGEHSRVIHRDLKSANILLDDNLEAKICDFGLSRLSPRNQQDTHVRTKAAGTRFYMDPSYVESSTLTKESDIYSFGVIMFEISSGMMAYHARRFKDSKELYLIYLVRSY

HMMPfam: PF07714
IPR001245
29-234 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

TLVGDGGFGMVYRGQLSNHWKKQLLAIKRLDPKGYQGTKEFHNEVKLVSSFNHPNIIPFVGYCDDENEKIIVFEYATNRSLEYHLQDRDRRSRLTWEQRLKICLGAAYGLKYLHSGVGEHSRVIHRDLKSANILLDDNLEAKICDFGLSRLSPRNQQDTHVRTKAAGTRFYMDPSYVESSTLTKESDIYSFGVIMFEISSGMMAYH

PatternScan: PS00107
IPR017441
31-56 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGDGGFGMVYRGQLSNHWKKQLLAIK

Gene3D: G3DSA:1.10.510.10
90-236 no description

YCDDENEKIIVFEYATNRSLEYHLQDRDRRSRLTWEQRLKICLGAAYGLKYLHSGVGEHSRVIHRDLKSANILLDDNLEAKICDFGLSRLSPRNQQDTHVRTKAAGTRFYMDPSYVESSTLTKESDIYSFGVIMFEISSGMMAYHAR

PatternScan: PS00108
IPR008271
151-163 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKSANILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox