PRGDB00192113 (Mdo.10846)

From PRG Wiki
Jump to: navigation, search
Mdo.10846
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 226741940 (GO497663)
Gene Class T
Domain Type TIR, LRR
Gene Species Malus x domestica

Comment?

CAC82811.1| resistance gene-like [Solanum tuberosum subsp. andigena], mRNA sequence

DNA Sequence

ATCGAATTCCGTTGCTGTCGAAGCTTCGAAGGGGAGAAGAAAAGGAACACCCACCGATCCCAGCCGCAGCTAGGATCGGCGGCACCAAATTTGAACACGATTGGGAATCACTCACACGAAACAGTGAGAATCACCCTCAAGCAGAGGGAAGGTCTCTCACAGGGAGCGTGCTGCTCATGGTTTATGCTCCCTATATGAGTGCAGATTGCTTGTGAAAATAATCTCATTTGTTCTGTTGTGAGAACCACATTTCCAATGGCATCAAGCACTTTGGGTTTGAATTCATCTCCTCCAGATGATAGGTTGAAATATGATGTATTTTTGAGTTTTCGAGGAGAAGACACGAGAAAGGGTTTTGTAAGTCATCTATATGAAGCGCTTGAGAACGCCGGCGTAAAAACTTTCCACGATGATGCTCCAAGAGATATTAGCCCAGAACTCAAGGCTGCAATTCAGAATTCGAGGACTGCAATTACTTTTCTGGGAGAGAATTATGCAACGTCGCCATGGGCATTGGAGGAGCTTGACCTGATTCTTAAATCCCATGGAAAAAGAAAAACGGTGCTACCAATTTTCTATAATGTCGATCCCTCTGACGTACGATATCAAACAGGGAGTTTTGCTGAAGCCTTTGCTAGACACGAAGAAACATAT


Protein sequences

Name Description Sequence
Mdo.10846 translated coding region predicted by ESTScan from UniGene Mdo.10846

XRIPLLSKLRRGEEKEHPPIPAAARIGGTKFEHDWESLTRNSENHPQAEGRSLTGSVLLMVYAPYMMQIACENNLICSVVRTTFPMASSTLGLNSSPPDDRLKYDVFLSFRGEDTRKGFVSHLYEALENAGVKTFHDDAPRDISPELKAAIQNSRTAITFLGENYATSPWALEELDLILKSHGKRKTVLPIFYNVDPSDVRYQTGSFAEAFARHEETY

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
92-214 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

GLNSSPPDDRLKYDVFLSFRGEDTRKGFVSHLYEALENAGVKTFHDDAPRDISPELKAAIQNSRTAITFLGENYATSPWALEELDLILKSHGKRKTVLPIFYNVDPSDVRYQTGSFAEAFARH

Gene3D: G3DSA:3.40.50.10140
99-215 no description

DDRLKYDVFLSFRGEDTRKGFVSHLYEALENAGVKTFHDDAPRDISPELKAAIQNSRTAITFLGENYATSPWALEELDLILKSHGKRKTVLPIFYNVDPSDVRYQTGSFAEAFARHE

ProfileScan: PS50104
IPR000157
102-218 TIR
Toll/interleukin-1 receptor homology (TIR) domain

LKYDVFLSFRGEDTRKGFVSHLYEALENAGVKTFHDDAPRDISPELKAAIQNSRTAITFLGENYATSPWALEELDLILKSHGKRKTVLPIFYNVDPSDVRYQTGSFAEAFARHEETY

HMMSmart: SM00255
IPR000157
103-217 Toll
Toll/interleukin-1 receptor homology (TIR) domain

KYDVFLSFRGEDTRKGFVSHLYEALENAGVKTFHDDAPRDISPELKAAIQNSRTAITFLGENYATSPWALEELDLILKSHGKRKTVLPIFYNVDPSDVRYQTGSFAEAFARHEET

HMMPfam: PF01582
IPR000157
106-216 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFLSFRGEDTRKGFVSHLYEALENAGVKTFHDDAPRDISPELKAAIQNSRTAITFLGENYATSPWALEELDLILKSHGKRKTVLPIFYNVDPSDVRYQTGSFAEAFARHEE

HMMPanther: PTHR23155
111-207 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RGEDTRKGFVSHLYEALENAGVKTFHDDAPRDISPELKAAIQNSRTAITFLGENYATSPWALEELDLILKSHGKRKTVLPIFYNVDPSDVRYQTGSF

HMMPanther: PTHR23155:SF344
111-207 SUBFAMILY NOT NAMED

RGEDTRKGFVSHLYEALENAGVKTFHDDAPRDISPELKAAIQNSRTAITFLGENYATSPWALEELDLILKSHGKRKTVLPIFYNVDPSDVRYQTGSF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox