PRGDB00192370 (Mtr.14712)

From PRG Wiki
Jump to: navigation, search
Mtr.14712
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 357437952 (XM_003589204)
Gene Class RPW8-NL
Domain Type NBS, LRR, RPW8, Others
Gene Species Medicago truncatula

Comment?

Medicago truncatula Nbs-lrr resistance protein (MTR_1g021110) mRNA, complete cds

DNA Sequence

ATGGCCTTAACGGACTTTTTTTCCTTAACAAATGAAGATTTATGGAAAATGCTTGCAGCAATTTCACGCAAAACATTCAACTCTAGATCAAGCGCTGAACAGCTCTTAACCTTCATCCGCGAAATTCTTCCAACAATTGAACAAATCAAATACTCCGGCGTCGAACTTCCACCGCCGAGACAATCTCATCTTGATCGTCTCTCCGAGATTCTCCGCTCCGGCGTTGAGCTTTCTCATCAAGTCCTCGCCACTAGTCGCTGGAACGTTTATCGTAACTTTCAGCTTGCGAAGAAGATGGAGAATCTTGAAGAGACTGTCACACAAATCTTGCAGGTTCCGATGCAAGCTTATATACTTGCTGATATCAACCATGTAAGAGCCGAGATGACGGAGCGGTTTGACCGGATTGAGGAGTCGAACCGGAGGATGGAGCGGTTTTTTGGAGGGATGAAGATTGGCGTTGGTGGTGTTGGGTGGGTTGAGGGAGCTGTGAGGTCTAGTGAGGAAGATGAGGGTAGTTTGGGGAATTTGGATTTGAGTTTTGGTTTGGAGTTTGGGAAGAATAAGGTTATGGAAATGGTTGTTGGAAGGAAAGATTTTTGTCTTGTTGGAATTTCTGGGATTGGTGGATCTGGGAAAACTACTCTTGCCAGAGAGATTTGTAGAGATGAACAAGTGAGAGGCTATTTCAAAGAAAGGATTTTGTTTTTGACTGTCTCGCAGTCTCCGAATGTGGAGCAGCTGAGGGCAAAGATTTGGGGACACATAATGGGAAATGGAAGTTTCAATACCAATTATGTTGTTCCTCAATGGAAGCTGCAATATGAATGCAGCGGGAGCCAACCTCAAATCCTTGTTATTCTGGATGATGTGTGGTCACCTTCTGTGCTGGAGCAGCTTGTGTTTAGAATGCCTAATTGCAAGTTCATTGTGGTTTCCAGGTTCATATTCCCCATTTTTAATGCAACTTATAAAGTTGAATTGTTGGACAAAGATGATGCACTGTCTTTGTTCTGTCACCACGCTTTCGGACAGAAATCAATTCCTTTCGCAGCTAATCAGAATTTAGTCAAACAGGTTGTGGCTGAATGTGGAAATCTTCCACTAGCTCTTAAAGTGATTGGCGCTTCGTTGCGAGATCAAAATGAAATGTTTTGGTTAAGTGTTAAAACAAGGCTTTCTCAAGGGTTAAGTATAGATGAATCCTATGAACGTAATCTGATTGATAGAATGGCAATCAGTACTAATTACTTACCCGAAAAGATCAAGGAGTGTTTCTTGGACCTTTGCTCCTTTCCTGAGGATAAAAAGATTCCTCTAGAAGTTCTAATCAATATGTGGGTTGAAATCCATGATATTCATGAAACAGAAGCATATGCAATTGTGGTTGAGCTTTCAAACAAGAATCTCCTCACCTTAGTGGAAGAGGCACGTGCTGGTGGTATGTATAGCAGTTGCTTTGAGATCTCTGTTACTCAACATGATATATTAAGAGATCTTGCCCTTAATTTGAGCAACCGTGGAAACATTAATCAACGCCGAAGATTAGTTATGCCGAAACGAGAAGATAATGGACAGCTTCCTAAAGAATGGCTGAGATATGCTGACCAACCGTTCGAAGCTCAAATTGTTTCAATTCACACTGGTGAAATGAGAAAAAGTGACTGGTGTAATTTGGAATTTCCTAAGGCTGAAGTACTGATTATTAATTTCACATCCAGTGAATACTTCTTACCTCCCTTCATAAATAGAATGCCAAAATTGAGAGCATTAATGGTAATAAACCACAGCACTTCATATGCTTGTCTTCACAATATATCGGTTTTCAAGAATTTAACCAACTTGAGGAGCCTTTGGTTTGAAAAAGTTTCCATCCCACACTTATCAGGCATAGTCATGGAAAGCTTGAGGAAATTGTTTATAGTCCTTTGTAAGATCAACAACAGTCTTGAAGGAAAAGATTCAAACATCGCCGATATCTTCCCTAACATCTCAGAGCTCACGCTTGATCACTGTGAGGATGTAACCGAGTTACCTTCAAGCATTTGCAGGATACAGTCACTACAAAACTTGAGTCTTACTAACTGTCATAGTTTAACACGATTACCTATTGAATTAGGCTCACTAAGATATCTAGAGATTCTACGGTTATATGCTTGTCCAAATTTGAGAACACTTCCTCCTAGCATCTGTGGAATGACTAGATTGAAGTATATCGACATTTCTCAATGTGTTTACCTTGCAAGCTTCCCTGATGCAATTGGTAAGTTGGTAAATTTAGAGAAAATCGACATGAGGGAATGTCCGATGATTACAAATATACCGAAGTCTGCATTGTCATTGAATTCTTTGCAGCTTGTAATTTGTGATGATGAAGTGTCTTGGATGTGGAAGGAAGTCCAGAAGGTCAAGCTTAATGTTGATATTCAAGTAGTAGAGATTGAATATGATCTAGATTGGCTTAGAGAATAACTGATAATGATTATGATGTTTTTTGTGTTCGTATTCAGAATTCTTTGTAAATCCTTGTTCATATTGTAACCTTTATTTCAAATGGAAATTGTATCAGGCCATAATCTTTTTGGTAGTCT


Protein sequences

Name Description Sequence
Mtr.14712 translated coding region predicted by ESTScan from UniGene Mtr.14712

MALTDFFSLTNEDLWKMLAAISRKTFNSRSSAEQLLTFIREILPTIEQIKYSGVELPPPRQSHLDRLSEILRSGVELSHQVLATSRWNVYRNFQLAKKMENLEETVTQILQVPMQAYILADINHVRAEMTERFDRIEESNRRMERFFGGMKIGVGGVGWVEGAVRSSEEDEGSLGNLDLSFGLEFGKNKVMEMVVGRKDFCLVGISGIGGSGKTTLAREICRDEQVRGYFKERILFLTVSQSPNVEQLRAKIWGHIMGNGSFNTNYVVPQWKLQYECSGSQPQILVILDDVWSPSVLEQLVFRMPNCKFIVVSRFIFPIFNATYKVELLDKDDALSLFCHHAFGQKSIPFAANQNLVKQVVAECGNLPLALKVIGASLRDQNEMFWLSVKTRLSQGLSIDESYERNLIDRMAISTNYLPEKIKECFLDLCSFPEDKKIPLEVLINMWVEIHDIHETEAYAIVVELSNKNLLTLVEEARAGGMYSSCFEISVTQHDILRDLALNLSNRGNINQRRRLVMPKREDNGQLPKEWLRYADQPFEAQIVSIHTGEMRKSDWCNLEFPKAEVLIINFTSSEYFLPPFINRMPKLRALMVINHSTSYACLHNISVFKNLTNLRSLWFEKVSIPHLSGIVMESLRKLFIVLCKINNSLEGKDSNIADIFPNISELTLDHCEDVTELPSSICRIQSLQNLSLTNCHSLTRLPIELGSLRYLEILRLYACPNLRTLPPSICGMTRLKYIDISQCVYLASFPDAIGKLVNLEKIDMRECPMITNIPKSALSLNSLQLVICDDEVSWMWKEVQKVKLNVDIQVVEIEYDLDWLRE

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-148 RPW8
Powdery mildew resistance protein, RPW8 domain

MALTDFFSLTNEDLWKMLAAISRKTFNSRSSAEQLLTFIREILPTIEQIKYSGVELPPPRQSHLDRLSEILRSGVELSHQVLATSRWNVYRNFQLAKKMENLEETVTQILQVPMQAYILADINHVRAEMTERFDRIEESNRRMERFFG

HMMPfam: PF05659
IPR008808
16-136 RPW8
Powdery mildew resistance protein, RPW8 domain

KMLAAISRKTFNSRSSAEQLLTFIREILPTIEQIKYSGVELPPPRQSHLDRLSEILRSGVELSHQVLATSRWNVYRNFQLAKKMENLEETVTQILQVPMQAYILADINHVRAEMTERFDRI

HMMPanther: PTHR23155
29-823 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RSSAEQLLTFIREILPTIEQIKYSGVELPPPRQSHLDRLSEILRSGVELSHQVLATSRWNVYRNFQLAKKMENLEETVTQILQVPMQAYILADINHVRAEMTERFDRIEESNRRMERFFGGMKIGVGGVGWVEGAVRSSEEDEGSLGNLDLSFGLEFGKNKVMEMVVGRKDFCLVGISGIGGSGKTTLAREICRDEQVRGYFKERILFLTVSQSPNVEQLRAKIWGHIMGNGSFNTNYVVPQWKLQYECSGSQPQILVILDDVWSPSVLEQLVFRMPNCKFIVVSRFIFPIFNATYKVELLDKDDALSLFCHHAFGQKSIPFAANQNLVKQVVAECGNLPLALKVIGASLRDQNEMFWLSVKTRLSQGLSIDESYERNLIDRMAISTNYLPEKIKECFLDLCSFPEDKKIPLEVLINMWVEIHDIHETEAYAIVVELSNKNLLTLVEEARAGGMYSSCFEISVTQHDILRDLALNLSNRGNINQRRRLVMPKREDNGQLPKEWLRYADQPFEAQIVSIHTGEMRKSDWCNLEFPKAEVLIINFTSSEYFLPPFINRMPKLRALMVINHSTSYACLHNISVFKNLTNLRSLWFEKVSIPHLSGIVMESLRKLFIVLCKINNSLEGKDSNIADIFPNISELTLDHCEDVTELPSSICRIQSLQNLSLTNCHSLTRLPIELGSLRYLEILRLYACPNLRTLPPSICGMTRLKYIDISQCVYLASFPDAIGKLVNLEKIDMRECPMITNIPKSALSLNSLQLVICDDEVSWMWKEVQKVKLNVDIQVVEIEYDLDWLRE

HMMPanther: PTHR23155:SF282
29-823 PTHR23155:SF282,SUBFAMILY NOT NAMED

RSSAEQLLTFIREILPTIEQIKYSGVELPPPRQSHLDRLSEILRSGVELSHQVLATSRWNVYRNFQLAKKMENLEETVTQILQVPMQAYILADINHVRAEMTERFDRIEESNRRMERFFGGMKIGVGGVGWVEGAVRSSEEDEGSLGNLDLSFGLEFGKNKVMEMVVGRKDFCLVGISGIGGSGKTTLAREICRDEQVRGYFKERILFLTVSQSPNVEQLRAKIWGHIMGNGSFNTNYVVPQWKLQYECSGSQPQILVILDDVWSPSVLEQLVFRMPNCKFIVVSRFIFPIFNATYKVELLDKDDALSLFCHHAFGQKSIPFAANQNLVKQVVAECGNLPLALKVIGASLRDQNEMFWLSVKTRLSQGLSIDESYERNLIDRMAISTNYLPEKIKECFLDLCSFPEDKKIPLEVLINMWVEIHDIHETEAYAIVVELSNKNLLTLVEEARAGGMYSSCFEISVTQHDILRDLALNLSNRGNINQRRRLVMPKREDNGQLPKEWLRYADQPFEAQIVSIHTGEMRKSDWCNLEFPKAEVLIINFTSSEYFLPPFINRMPKLRALMVINHSTSYACLHNISVFKNLTNLRSLWFEKVSIPHLSGIVMESLRKLFIVLCKINNSLEGKDSNIADIFPNISELTLDHCEDVTELPSSICRIQSLQNLSLTNCHSLTRLPIELGSLRYLEILRLYACPNLRTLPPSICGMTRLKYIDISQCVYLASFPDAIGKLVNLEKIDMRECPMITNIPKSALSLNSLQLVICDDEVSWMWKEVQKVKLNVDIQVVEIEYDLDWLRE

superfamily: SSF52540
163-380 SSF52540

AVRSSEEDEGSLGNLDLSFGLEFGKNKVMEMVVGRKDFCLVGISGIGGSGKTTLAREICRDEQVRGYFKERILFLTVSQSPNVEQLRAKIWGHIMGNGSFNTNYVVPQWKLQYECSGSQPQILVILDDVWSPSVLEQLVFRMPNCKFIVVSRFIFPIFNATYKVELLDKDDALSLFCHHAFGQKSIPFAANQNLVKQVVAECGNLPLALKVIGASLRD

HMMPfam: PF00931
IPR002182
189-449 NB-ARC,NBS
NB-ARC

KVMEMVVGRKDFCLVGISGIGGSGKTTLAREICRDEQVRGYFKERILFLTVSQSPNVEQLRAKIWGHIMGNGSFNTNYVVPQWKLQYECSGSQPQILVILDDVWSPSVLEQLVFRMPNCKFIVVSRFIFPIFNATYKVELLDKDDALSLFCHHAFGQKSIPFAANQNLVKQVVAECGNLPLALKVIGASLRDQNEMFWLSVKTRLSQGLSIDESYERNLIDRMAISTNYLPEKIKECFLDLCSFPEDKKIPLEVLINMWVE

Gene3D: G3DSA:3.40.50.300
198-222 G3DSA:3.40.50.300

KDFCLVGISGIGGSGKTTLAREICR

FPrintScan: PR00364
IPR000767
202-217 DISEASERSIST
Disease resistance protein

LVGISGIGGSGKTTLA

FPrintScan: PR00364
IPR000767
278-292 DISEASERSIST
Disease resistance protein

SGSQPQILVILDDVW

FPrintScan: PR00364
IPR000767
364-378 DISEASERSIST
Disease resistance protein

CGNLPLALKVIGASL

Gene3D: G3DSA:3.80.10.10
569-785 G3DSA:3.80.10.10

INFTSSEYFLPPFINRMPKLRALMVINHSTSYACLHNISVFKNLTNLRSLWFEKVSIPHLSGIVMESLRKLFIVLCKINNSLEGKDSNIADIFPNISELTLDHCEDVTELPSSICRIQSLQNLSLTNCHSLTRLPIELGSLRYLEILRLYACPNLRTLPPSICGMTRLKYIDISQCVYLASFPDAIGKLVNLEKIDMRECPMITNIPKSALSLNSLQ

superfamily: SSF52058
579-807 SSF52058,LRR

PPFINRMPKLRALMVINHSTSYACLHNISVFKNLTNLRSLWFEKVSIPHLSGIVMESLRKLFIVLCKINNSLEGKDSNIADIFPNISELTLDHCEDVTELPSSICRIQSLQNLSLTNCHSLTRLPIELGSLRYLEILRLYACPNLRTLPPSICGMTRLKYIDISQCVYLASFPDAIGKLVNLEKIDMRECPMITNIPKSALSLNSLQLVICDDEVSWMWKEVQKVKLNV

FPrintScan: PR00364
IPR000767
683-699 DISEASERSIST
Disease resistance protein

CRIQSLQNLSLTNCHSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox