PRGDB00192544 (Mtr.24941)

From PRG Wiki
Jump to: navigation, search
Mtr.24941
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 309385764 (HM769886)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Medicago truncatula

Comment?

Medicago truncatula somatic embryogenesis receptor kinase 3 splice variant 6 (SERK3) mRNA, complete cds, alternatively spliced

DNA Sequence

CAACTTTCTTGATGATCACAGTATCTTATGATGAGGTTGTCACAGGTGAGCCTGAACCCACTCTAGCTAGCTTGGTTATATACCATGATATCGTGAATGTGGACTATATAAAACATGGAGAGAGTGATACCCTTATTGCATTGAAGAGCAACTTAAATGATCCTAACAGTGTTTTTCAAAGTTGGAATGCTACCAATGTCAATCCCTGCGAGTGGTTTCATGTTACATGCAATGATGATAAAAGTGTGATCCTTATGGAGCTTTCTAGTAATAATATAACAGGAAAAATCCCAGAAGAGTTAGGAAATTTGACAAACTTAGTGAGCTTGGATCTTTACTTGAACCATTTAAGCGGTACCATACTGAATACATTGGGCAACCTTCACAAACTATGTTTCCTGCGTCTCAACAATAACAGCTTGACTGGAGTCATTCCCATTTCTTTGTCAAATGTTGCTACGCTGCAAGTTCTGTGAGTGTTCCTCCTTTATTTAGATTTCCTCCGAGTGATAGTCGGAGTAGATATTTTTTGTTTTGTTTTGAAGAAATCAAAGTAGATTACTATTTATGTTAGAATCAATATACTTCTGTGTAAATTGACACAACAGCGATCTCTCAAACAACAATCTAGAAGGGGATATCCCAGTGAATGGTTCATTTTTATTATTTACCTCTTCCAGGTTAGTGTAAATCATTATGTTCTTATTTAGGCCTTATTGTTGACAGATGACCTGAAACTTTGCTAATTCCCCGTGTTTGACTTCACAGTTATCAAAATAATCCTCGTTTGAAACAACCAAAAATCATTCATGCACCACTTTCTCCAGCATCATCAGCTTCTTCAGGTAACAGTAATACTGGAGCTATTGCTGGAGGAGTTGCTGCAGGTGCTGCTCTGTTGTTCGCAGCTCCAGCAATTGCACTTGTTTATTGGCAAAAAAGAAAACAATGGGGTCATTTCTTTGACGTTCCTGGTTAGTTGAATAACAGAAAAGATGGTATACATGCTGATAAATGCTGTGTTTTATAGTTACTATTACTTGTGAACCAACCCACTTGGGTTGGCATAGTGGTACTGGCTTGGGATTTAGGAGTGTGCTTCTCCTCAAGGTCTCAGTTCGATTCTCTCTGGTGTCAATTTGGGTGGGCTAATTTAGCTTCTTCAAAAAAAAAAACTATTACTTGTGAACCAATATTTTAATTGTCTTTTACTGCGGCAGCTGAGGAGGATCTTGAACACCTTGTTCAGATTACAAGGTTTTCTCTACGTGAACGGCTAGTAGAAACAGATAACTTCAGTAACGAAAACGTTCTAGGTAGAGGTAGATTTGGAAAGGTTTACAAAGGTCACTTAACTGATGGCACTCCTGTAGCAATACGAAGACTTAAAGAGGAACGCGTCGCGGGTGGAAAGCTGCAGTTTCAAACTGAAGTTGAATTGATCAGCATGGCTGTGCATCATAATTTGCTTCGCCTTCGTGATTTTTGCATGACACCTACTGAACGCTTGCTTGTGTATCCTTACATGGCTAATGGAAGTGTATCGTGTTTACGAGAACGTAATGGCTCTCAACCTCCGCTTGAGTGGCCAATGCGGAAAAATATTGCGTTGGGATCTGCCAGGGGGATTGCTTACTTGCATTATAGTTGTGACCCTAAGATTATTCACCGTGATGTGAAAGCTGCAAATATATTGTTGGATGAGGAATTTGAAGCAATTGTTGGAGATTTTGGTTATGCAATGCTTATGGATTACAAAGATACCCATGATACTACTGCTGTCTTTGGTACGATTGGGCATATAGCACCTGAATATCTCTTAACTGGAAGGTCTTCAGAAAAGACCGATGTTTTTGCATATGGTGTGATGCTTCTTGAACTAATAACTGGACCGAGGGCTTCTGATCTAGCACGTCTTGCTGATGATGATGTGATATTGCTTGATTGGGTTAAAGGACTTCTTAAAGAGAAGAAGTTCGAAACACTGGTAGATGCAGAGTTAAAGGGAAATTATGATGATGATGAGGTAGAGCAGTTAATCCAAGTTGCTTTACTATGCACACAAGGGTCCCCTATGGAAAGACCTAAGATGTCTGAGGTGGTGAGAATGCTAGAAGGCGATGGTTTGGCCGAAAAATGGATGCAATGGCAGAAAGAAGAGAAGTACTGACAAGATTTTAGCAACAACCGCATGCATCACCCTTCTAATGCAAATCGGATATAGTAGTAGATTCAACTTCACACATCGAGCCAGATGAACTCTAAGGTCCTAGACGATCCGTT


Protein sequences

Name Description Sequence
Mtr.24941 translated coding region predicted by ESTScan from UniGene Mtr.24941

TAAAEEDLEHLVQITRFSLRERLVETDNFSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAEKWMQWQKEEKYXQDFSNNRMHHPSNANRIXXXIQLHTSSQMNSKVLDDPX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-324 Protein kinase-like (PK-like)
Protein kinase-like domain

TAAAEEDLEHLVQITRFSLRERLVETDNFSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAEKWMQWQKEEKYXQDFS

HMMPanther: PTHR24420:SF351
4-322 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

AEEDLEHLVQITRFSLRERLVETDNFSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAEKWMQWQKEEKYXQD

HMMPanther: PTHR24420
4-322 FAMILY NOT NAMED,FAMILY NOT NAMED

AEEDLEHLVQITRFSLRERLVETDNFSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAEKWMQWQKEEKYXQD

Gene3D: G3DSA:3.30.200.20
14-106 no description

ITRFSLRERLVETDNFSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYM

HMMSmart: SM00220
IPR002290
29-311 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAEKWM

ProfileScan: PS50011
IPR000719
29-311 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAEKWM

HMMSmart: SM00219
IPR020635
29-301 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRML

HMMPfam: PF00069
IPR000719
31-298 Pkinase,Ser-thr
Protein kinase, catalytic domain

NENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVV

Gene3D: G3DSA:1.10.510.10
108-301 no description

NGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRML

PatternScan: PS00108
IPR008271
151-163 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL

Seg: seg
229-240 seg

RASDLARLADDD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox