PRGDB00192547 (Mtr.24944)

From PRG Wiki
Jump to: navigation, search
Mtr.24944
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 309385762 (HM769885)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Medicago truncatula

Comment?

Medicago truncatula somatic embryogenesis receptor kinase 3 splice variant 5 (SERK3) mRNA, complete cds, alternatively spliced

DNA Sequence

CAACTTTCTTGATGATCACAGTATCTTATGATGAGGTTGTCACAGGTGAGCCTGAACCCACTCTAGCTAGCTTGGTTATATACCATGATATCGTGAATGTGGACTATATAAAACATGGAGAGAGTGATACCCTTATTGCATTGAAGAGCAACTTAAATGATCCTAACAGTGTTTTTCAAAGTTGGAATGCTACCAATGTCAATCCCTGCGAGTGGTTTCATGTTACATGCAATGATGATAAAAGTGTGATCCTTATGGAGCTTTCTAGTAATAATATAACAGGAAAAATCCCAGAAGAGTTAGGAAATTTGACAAACTTAGTGAGCTTGGATCTTTACTTGAACCATTTAAGCGGTACCATACTGAATACATTGGGCAACCTTCACAAACTATGTTTCCTGCGTCTCAACAATAACAGCTTGACTGGAGTCATTCCCATTTCTTTGTCAAATGTTGCTACGCTGCAAGTTCTGTGAGTGTTCCTCCTTTATTTAGATTTCCTCCGAGTGATAGTCGGAGTAGATATTTTTTGTTTTGTTTTGAAGAAATCAAAGTAGATTACTATTTATGTTAGAATCAATATACTTCTGTGTAAATTGACACAACAGCGATCTCTCAAACAACAATCTAGAAGGGGATATCCCAGTGAATGGTTCATTTTTATTATTTACCTCTTCCAGTTATCAAAATAATCCTCGTTTGAAACAACCAAAAATCATTCATGCACCACTTTCTCCAGCATCATCAGCTTCTTCAGGTAACAGTAATACTGGAGCTATTGCTGGAGGAGTTGCTGCAGGTGCTGCTCTGTTGTTCGCAGCTCCAGCAATTGCACTTGTTTATTGGCAAAAAAGAAAACAATGGGGTCATTTCTTTGACGTTCCTGGTTAGTTGAATAACAGAAAAGATGGTATACATGCTGATAAATGCTGTGTTTTATAGTTACTATTACTTGTGAACCAACCCACTTGGGTTGGCATAGTGGTACTGGCTTGGGATTTAGGAGTGTGCTTCTCCTCAAGGTCTCAGTTCGATTCTCTCTGGTGTCAATTTGGGTGGGCTAATTTAGCTTCTTCAAAAAAAAAAACTATTACTTGTGAACCAATATTTTAATTGTCTTTTACTGCGGCAGCTGAGGAGGATCTTGAACACCTTGTTCAGATTACAAGGTTTTCTCTACGTGAACGGCTAGTAGAAACAGATAACTTCAGTAACGAAAACGTTCTAGGTAGAGGTAGATTTGGAAAGGTTTACAAAGGTCACTTAACTGATGGCACTCCTGTAGCAATACGAAGACTTAAAGAGGAACGCGTCGCGGGTGGAAAGCTGCAGTTTCAAACTGAAGTTGAATTGATCAGCATGGCTGTGCATCATAATTTGCTTCGCCTTCGTGATTTTTGCATGACACCTACTGAACGCTTGCTTGTGTATCCTTACATGGCTAATGGAAGTGTATCGTGTTTACGAGAACGTAATGGCTCTCAACCTCCGCTTGAGTGGCCAATGCGGAAAAATATTGCGTTGGGATCTGCCAGGGGGATTGCTTACTTGCATTATAGTTGTGACCCTAAGATTATTCACCGTGATGTGAAAGCTGCAAATATATTGTTGGATGAGGAATTTGAAGCAATTGTTGGAGATTTTGGTTATGCAATGCTTATGGATTACAAAGATACCCATGATACTACTGCTGTCTTTGGTACGATTGGGCATATAGCACCTGAATATCTCTTAACTGGAAGGTCTTCAGAAAAGACCGATGTTTTTGCATATGGTGTGATGCTTCTTGAACTAATAACTGGACCGAGGGCTTCTGATCTAGCACGTCTTGCTGATGATGATGTGATATTGCTTGATTGGGTTAAAGGACTTCTTAAAGAGAAGAAGTTCGAAACACTGGTAGATGCAGAGTTAAAGGGAAATTATGATGATGATGAGGTAGAGCAGTTAATCCAAGTTGCTTTACTATGCACACAAGGGTCCCCTATGGAAAGACCTAAGATGTCTGAGGTGGTGAGAATGCTAGAAGGCGATGGTTTGGCCGAAAAATGGATGCAATGGCAGAAAGAAGAGAAGTACTGACAAGATTTTAGCAACAACCGCATGCATCACCCTTCTAATGCAAATCGGATATAGTAGTAGATTCAACTTCACACATCGAGCCAGATGAACTCTAAGGTCCTAGACGATCCGTTTGAAGATTCTATCATATCCACTAGTGAATACACAATCCTTCTTCCTCTGCCTGAA


Protein sequences

Name Description Sequence
Mtr.24944 translated coding region predicted by ESTScan from UniGene Mtr.24944

XTFLMITVSYDEVVTGEPEPTLASLVIYHDIVNVDYIKHGESDTLIALKSNLNDPNSVFQSWNATNVNPCEWFHVTCNDDKSVILMELSSNNITGKIPEELGNLTNLVSLDLYLNHLSGTILNTLGNLHKLCFLRLNNNSLTGVIPISLSNVATLQVLXVFLLYLDFLRVIVGVDIFCFVLKKSKRLLFMLESIYFCVNXHNSDLSNNNLEGDIPVNGSFLLFTSSSYQNNPRLKQPKIIHAPLSPASSASSGNSNTGAIAGGVAAGAALLFAAPAIALVYWQKRKQWGHFFDVPGXLNNRKDGIHADKCCVLXLLLLVNQPTWVGIVVLAWDLGVCFSSRSQFDSLWCQFGWANLASSKKKTITCEPIFXLSFTAAAEEDLEHLVQITRFSLRERLVETDNFSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAEKWMQWQKEEKYXQDFSNNRMHHPSNANRIXXXIQLHTSSQMNSKVLDDPFEDSIISTSEYTILLPLPE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF351
3-742 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

FLMITVSYDEVVTGEPEPTLASLVIYHDIVNVDYIKHGESDTLIALKSNLNDPNSVFQSWNATNVNPCEWFHVTCNDDKSVILMELSSNNITGKIPEELGNLTNLVSLDLYLNHLSGTILNTLGNLHKLCFLRLNNNSLTGVIPISLSNVATLQVLXVFLLYLDFLRVIVGVDIFCFVLKKSKRLLFMLESIYFCVNXHNSDLSNNNLEGDIPVNGSFLLFTSSSYQNNPRLKQPKIIHAPLSPASSASSGNSNTGAIAGGVAAGAALLFAAPAIALVYWQKRKQWGHFFDVPGXLNNRKDGIHADKCCVLXLLLLVNQPTWVGIVVLAWDLGVCFSSRSQFDSLWCQFGWANLASSKKKTITCEPIFXLSFTAAAEEDLEHLVQITRFSLRERLVETDNFSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAEKWMQWQKEEKYXQDFSNNRMHHPSNANRIXXXIQLHTSSQMNSKVLDDPFEDSIISTSEY

HMMPanther: PTHR24420
3-742 FAMILY NOT NAMED,FAMILY NOT NAMED

FLMITVSYDEVVTGEPEPTLASLVIYHDIVNVDYIKHGESDTLIALKSNLNDPNSVFQSWNATNVNPCEWFHVTCNDDKSVILMELSSNNITGKIPEELGNLTNLVSLDLYLNHLSGTILNTLGNLHKLCFLRLNNNSLTGVIPISLSNVATLQVLXVFLLYLDFLRVIVGVDIFCFVLKKSKRLLFMLESIYFCVNXHNSDLSNNNLEGDIPVNGSFLLFTSSSYQNNPRLKQPKIIHAPLSPASSASSGNSNTGAIAGGVAAGAALLFAAPAIALVYWQKRKQWGHFFDVPGXLNNRKDGIHADKCCVLXLLLLVNQPTWVGIVVLAWDLGVCFSSRSQFDSLWCQFGWANLASSKKKTITCEPIFXLSFTAAAEEDLEHLVQITRFSLRERLVETDNFSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAEKWMQWQKEEKYXQDFSNNRMHHPSNANRIXXXIQLHTSSQMNSKVLDDPFEDSIISTSEY

superfamily: SSF52058
35-243 L domain-like,LRR

DYIKHGESDTLIALKSNLNDPNSVFQSWNATNVNPCEWFHVTCNDDKSVILMELSSNNITGKIPEELGNLTNLVSLDLYLNHLSGTILNTLGNLHKLCFLRLNNNSLTGVIPISLSNVATLQVLXVFLLYLDFLRVIVGVDIFCFVLKKSKRLLFMLESIYFCVNXHNSDLSNNNLEGDIPVNGSFLLFTSSSYQNNPRLKQPKIIHAP

Gene3D: G3DSA:3.80.10.10
41-215 no description

ESDTLIALKSNLNDPNSVFQSWNATNVNPCEWFHVTCNDDKSVILMELSSNNITGKIPEELGNLTNLVSLDLYLNHLSGTILNTLGNLHKLCFLRLNNNSLTGVIPISLSNVATLQVLXVFLLYLDFLRVIVGVDIFCFVLKKSKRLLFMLESIYFCVNXHNSDLSNNNLEGDIP

HMMPfam: PF08263
IPR013210
41-78 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ESDTLIALKSNLNDPNSVFQSWNATNVNPCEWFHVTCN

Seg: seg
155-168 seg

LQVLXVFLLYLDFL

Seg: seg
199-210 seg

NXHNSDLSNNNL

Seg: seg
245-280 seg

SPASSASSGNSNTGAIAGGVAAGAALLFAAPAIALV

Seg: seg
313-318 seg

LXLLLL

superfamily: SSF56112
IPR011009
373-683 Protein kinase-like (PK-like)
Protein kinase-like domain

SFTAAAEEDLEHLVQITRFSLRERLVETDNFSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAEK

Gene3D: G3DSA:3.30.200.20
388-480 no description

ITRFSLRERLVETDNFSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYM

ProfileScan: PS50011
IPR000719
403-685 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAEKWM

HMMSmart: SM00220
IPR002290
403-685 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRMLEGDGLAEKWM

HMMSmart: SM00219
IPR020635
403-675 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSNENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRML

HMMPfam: PF00069
IPR000719
405-672 Pkinase,Ser-thr
Protein kinase, catalytic domain

NENVLGRGRFGKVYKGHLTDGTPVAIRRLKEERVAGGKLQFQTEVELISMAVHHNLLRLRDFCMTPTERLLVYPYMANGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVV

Gene3D: G3DSA:1.10.510.10
482-675 no description

NGSVSCLRERNGSQPPLEWPMRKNIALGSARGIAYLHYSCDPKIIHRDVKAANILLDEEFEAIVGDFGYAMLMDYKDTHDTTAVFGTIGHIAPEYLLTGRSSEKTDVFAYGVMLLELITGPRASDLARLADDDVILLDWVKGLLKEKKFETLVDAELKGNYDDDEVEQLIQVALLCTQGSPMERPKMSEVVRML

PatternScan: PS00108
IPR008271
525-537 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL

Seg: seg
603-614 seg

RASDLARLADDD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox