PRGDB00192558 (Os.51866)

From PRG Wiki
Jump to: navigation, search
Os.51866
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 336088122 (AB604614)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa

Comment?

Oryza sativa Indica Group Os11gRGAC mRNA for NBS-LRR type protein, partial cds, cultivar: Kasalath

DNA Sequence

ATGGCGGTGGCGGAAGTCGGGGGAATGCTTGCATCTGCCGTCCTCAAGGTGGCGACCCAGAAGCTGGGCGCCGCCATAGCGGGCCGGGTCATGCTCCAGTGGAACTTCGACAAGGATCTGGAGGGGATGAAGGCCACGCTGGAGTCTGTGGACGCGGTGCTCAGGGACGCCGAGAGGCGGTCGATCCGCGACGCGGCGGTGCGGCTGTGGCTGAGGAGGCTCAAGGACGCCGCCTACGACATCTCCGACATGCTCGACGACCTGGAGGCCATCACTTCCAAATCGGATGCGGGGAAGTTGGGATGTGTGATGATCCCCAATCTGACTATTGCTCACAAGATTACCCTAGCTAATAAGATGAAGACGATAAGTGATGAACTGAAGGAGATCACTAATCAACATCTTAGCTTCAGATTCACGGAAGATAGCAGCTATAAGGAGCACAGAGTTACTGATAAACGGGAAACATCGTCCAAGGTGGAAGAAGCACGAGTTGTTGGGAGGACTGCAGAGAAGCGGATAATTATATCTTCTCTGTCCAAGAGAATGACTGAAGAGACCGTAATCCTTCCTATATATGGCATTGGAGGCATAGGCAAGACAACCTTGGCGAAACTGGTTTTCAACGCTTCCAAATTCAGAGACTACTCTAAGGTCTGGATATATGTGTCTCAGACATTTGACTTGAACAAAATTAGCAACTCTATAATTTCACAAGTATCGGAAAGTGAGAGCCAGTTGACTGAAAGGGAGATGATAAATAGGCGTCTTGATGAGCTACTTTCCGGTAGGAAGATTCTAATTGTTTTAGATGACCTATGGGAGAGGGATCAATTTCAGTTAGATGATTTGAAGACTATGTTAAAGGTTGGCAGGGGCAGCAGGGTGATTGCCATCGTAACCACCCGAGATAAGGACATTGCAGAGAAGATTTGCACCACTGAACCGTACAAACTAGAACCCCTGACAAATGACATGTGCTGGAAAATAATAAAAGAAAAGAGTGTCTTTGAAGCAAGAGATGACAAAGAACAATTGGAGAATATAGGAAGGGAAATAGCATCTAAATGTGGAGGTGTGGCTTTAGCAGCCAAATCACTTGGATATACTCTGCAACCCATGAAGTTTGATGAATGGGTATCAGTGAGAAACAACGATATCTGGAAGGCATCTACTTTCGAATGTACATCTTTGCCATATCATAATGTGCTTGCATCCTTGCGATTGAGCTGCAGCAATATGCCTCCAAACCTGAGGTTATGCTTTGCATATTGTGCAATCTTCTTAGAGAAGATTTGCACCACTGAACCGTACAAACTAGAACCCCTGACAAATGACATGTGCTGGAAAATAATAAAAGAAAAGAGTGTCTTTGAAGCAAGAGATGACAAAGAACAATTGGAGAATATAGGAAGGGAAATAGCATCTAAATGTGGAGGTGTGGCTTTAGCAGCCAAATCACTTGGATATACTCTGCAACCCATGAAGTTTGATGAATGGGTATCAGTGAGAAACAACGATATCTGGAAGGCATCTACTTTCGAATGTACATCTTTGCCATATCATAATGTGCTTGCATCCTTGCGATTGAGCTGCAGCAATATGCCTCCAAACCTGAGGTTATGCTTTGCATATTGTGCAATCTTCTT


Protein sequences

Name Description Sequence
Os.51866 translated coding region predicted by ESTScan from UniGene Os.51866

MAVAEVGGMLASAVLKVATQKLGAAIAGRVMLQWNFDKDLEGMKATLESVDAVLRDAERRSIRDAAVRLWLRRLKDAAYDISDMLDDLEAITSKSDAGKLGCVMIPNLTIAHKITLANKMKTISDELKEITNQHLSFRFTEDSSYKEHRVTDKRETSSKVEEARVVGRTAEKRIIISSLSKRMTEETVILPIYGIGGIGKTTLAKLVFNASKFRDYSKVWIYVSQTFDLNKISNSIISQVSESESQLTEREMINRRLDELLSGRKILIVLDDLWERDQFQLDDLKTMLKVGRGSRVIAIVTTRDKDIAEKICTTEPYKLEPLTNDMCWKIIKEKSVFEARDDKEQLENIGREIASKCGGVALAAKSLGYTLQPMKFDEWVSVRNNDIWKASTFECTSLPYHNVLASLRLSCSNMPPNLRLCFAYCAIFLEKICTTEPYKLEPLTNDMCWKIIKEKSVFEARDDKEQLENIGREIASKCGGVALAAKSLGYTLQPMKFDEWVSVRNNDIWKASTFECTSLPYHNVLASLRLSCSNMPPNLRLCFAYCAIFX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
11-288 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ASAVLKVATQKLGAAIAGRVMLQWNFDKDLEGMKATLESVDAVLRDAERRSIRDAAVRLWLRRLKDAAYDISDMLDDLEAITSKSDAGKLGCVMIPNLTIAHKITLANKMKTISDELKEITNQHLSFRFTEDSSYKEHRVTDKRETSSKVEEARVVGRTAEKRIIISSLSKRMTEETVILPIYGIGGIGKTTLAKLVFNASKFRDYSKVWIYVSQTFDLNKISNSIISQVSESESQLTEREMINRRLDELLSGRKILIVLDDLWERDQFQLDDLKTML

HMMPanther: PTHR23155:SF270
11-288 OS11G0211300 PROTEIN,OS11G0211300 PROTEIN

ASAVLKVATQKLGAAIAGRVMLQWNFDKDLEGMKATLESVDAVLRDAERRSIRDAAVRLWLRRLKDAAYDISDMLDDLEAITSKSDAGKLGCVMIPNLTIAHKITLANKMKTISDELKEITNQHLSFRFTEDSSYKEHRVTDKRETSSKVEEARVVGRTAEKRIIISSLSKRMTEETVILPIYGIGGIGKTTLAKLVFNASKFRDYSKVWIYVSQTFDLNKISNSIISQVSESESQLTEREMINRRLDELLSGRKILIVLDDLWERDQFQLDDLKTML

Coil: coil
40-61 coiled-coil

LEGMKATLESVDAVLRDAERRS

superfamily: SSF52540
148-392 P-loop containing nucleoside triphosphate hydrolases

HRVTDKRETSSKVEEARVVGRTAEKRIIISSLSKRMTEETVILPIYGIGGIGKTTLAKLVFNASKFRDYSKVWIYVSQTFDLNKISNSIISQVSESESQLTEREMINRRLDELLSGRKILIVLDDLWERDQFQLDDLKTMLKVGRGSRVIAIVTTRDKDIAEKICTTEPYKLEPLTNDMCWKIIKEKSVFEARDDKEQLENIGREIASKCGGVALAAKSLGYTLQPMKFDEWVSVRNNDIWKAST

HMMPfam: PF00931
IPR002182
171-431 NB-ARC,NBS
NB-ARC

EKRIIISSLSKRMTEETVILPIYGIGGIGKTTLAKLVFNASKFRDYSKVWIYVSQTFDLNKISNSIISQVSESESQLTEREMINRRLDELLSGRKILIVLDDLWERDQFQLDDLKTMLKVGRGSRVIAIVTTRDKDIAEKICTTEPYKLEPLTNDMCWKIIKEKSVFEARDDKEQLENIGREIASKCGGVALAAKSLGYTLQPMKFDEWVSVRNNDIWKASTFECTSLPYHNVLASLRLSCSNMPPNLRLCFAYCAIFLEK

Gene3D: G3DSA:3.40.50.300
179-313 no description

LSKRMTEETVILPIYGIGGIGKTTLAKLVFNASKFRDYSKVWIYVSQTFDLNKISNSIISQVSESESQLTEREMINRRLDELLSGRKILIVLDDLWERDQFQLDDLKTMLKVGRGSRVIAIVTTRDKDIAEKICT

FPrintScan: PR00364
IPR000767
189-204 DISEASERSIST
Disease resistance protein

ILPIYGIGGIGKTTLA

Seg: seg
232-246 seg

ISNSIISQVSESESQ

FPrintScan: PR00364
IPR000767
260-274 DISEASERSIST
Disease resistance protein

LLSGRKILIVLDDLW

FPrintScan: PR00364
IPR000767
357-371 DISEASERSIST
Disease resistance protein

CGGVALAAKSLGYTL

superfamily: SSF52540
428-513 P-loop containing nucleoside triphosphate hydrolases

FLEKICTTEPYKLEPLTNDMCWKIIKEKSVFEARDDKEQLENIGREIASKCGGVALAAKSLGYTLQPMKFDEWVSVRNNDIWKAST

HMMPfam: PF00931
IPR002182
434-549 NB-ARC,NBS
NB-ARC

TTEPYKLEPLTNDMCWKIIKEKSVFEARDDKEQLENIGREIASKCGGVALAAKSLGYTLQPMKFDEWVSVRNNDIWKASTFECTSLPYHNVLASLRLSCSNMPPNLRLCFAYCAIF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox