PRGDB00192571 (Os.100952)

From PRG Wiki
Jump to: navigation, search
Os.100952
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 336088124 (AB604615)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa

Comment?

Oryza sativa Japonica Group Os11gRGA1 mRNA for NBS-LRR type protein, partial cds, cultivar: Nipponbare, Sasanishiki, Mokoto, Aichi-asahi, Hitomebore

DNA Sequence

ATGGAGACCCTGAGCTCTGTCACTAATATCGTCGTGGGGAAGCTCTTCGCGCTACTGGAGAAGAAGTACGAGCAGTGGAGGGGCCTGGAGGACAGCATCGGTTTCATCAAGCGGGAGCTCCGCGTGATCCATGGCTTCCTGCACGACCAGCTCCCGCGGGATCGGAATGGGGAGGATCCGCCGATCAGCGCCGTGCAGGCCACATGCATCGACGAGCTCCGGGATCTGGCGCACGACATCGAGGACTGCCTCGACCGCTTCCTGCCCTGCGCCGCGTGCGAGCGCGATTCGTCGTTCCTCCGCCGCCTCGCGGCGGACTCTCGGTTCGCCGGCGAGGTCGAGAGGCTCAAGTCGCGGCTGGAGGAGGCGCACGAGCGGAGGGCTAACTACGGCGTCAACGGCGTCGCCGGCTCCGCCGCCGCAGCTGGCGGATCAAGCTCAGGCTCAGCAAATACGACGGATTACATGGCCCAGAGCTGTGGCCTTGTGGGCATCAACGTGCCCAGGCAAGAGCTTCTTGACCTGCTCCTGCTCGAGGACGTGGAGGGCCGGCCGGAGCGGATGCGCGTGATCTCCATCGTGGGATTCGGAGGCTCGGGGAAGACGACGCTCGCGAGGGCAGTGTACGACTGCCCCGACATCGCCGGCCAGTTCGACGGCCGCGCCTGGGTCGTGGCGTCCAAGCACAGAGATGATACCATGGGGCTCCTGTCGGCGTTACTCGGCCAAATTCGTCAGGAAGATGACCAAAGATTCAATCAAATTCCTCAGGATGATGAGCAAAGATTCCAGCTACAGTCCCAAGTCCAAGCTGATATCAGGCAACACCTGAATGCTAAGAGGTACCTTCTCGTGTTTGATGATATTGAGGAGAAGCAGTGGAACTGTATAAAATCAACCTTCCCTACAGAAACAAGAAGCAGAGTACTAGTGACAACGACTATTAAACCAGTTGCAAATGCCTGCAGCCATGGTACCGGTTCTGTGTACAATATGAGAACTCTGAATGTGAACCATTCCAAGGATTTGCTGCAATCTGTCCTAAAGGAATACTCTCCTGAGTTGGAGTTGGACTTGCCATCGATTCTGGAGAAATGCGACGGCCTCCCGCTTGCTCTGGTTAGTGTGGGAAACTTTCTATGGCGAGAAAGGATCACTGAATGTTACCGAAATCAAGTCTGCTGCAACCTAGGTCATCACATTGAGAAGGAGCACGCCTTTGCAGAACTGCGACAAGTTCTTGCGAACAACTACAACACTCTGCCTGGCCATCCCCTCAAGACCTGCTTACTGTACACGACTGTGTTCCCCAATGGCTGTTCCATCAGAAGGAGCAGTCTGATCAGGCGATGGTTAGCTGAAGGCTATGTACAATGCCAATATCCTCGCAGTTCACTGGAGGTTGCAGATGCAAACTTGGAGGAGCTAATGGACCGAAATATCATCAGGTCGATGGATGTTACCAACAATGGAAGGGCGAAGAACTGCAGGGCTCACGGTATCATGCACGAATTCATGCTGCACAAGTCCAGGTGTGATAATTTCATTGCATCCCTCCATGACCCAGATCGAAGCAAATGCCGCCACCTCTTCTTAACCCAGAGCCTTACAAGTGGAAATCAATCATACA


Protein sequences

Name Description Sequence
Os.100952 translated coding region predicted by ESTScan from UniGene Os.100952

METLSSVTNIVVGKLFALLEKKYEQWRGLEDSIGFIKRELRVIHGFLHDQLPRDRNGEDPPISAVQATCIDELRDLAHDIEDCLDRFLPCAACERDSSFLRRLAADSRFAGEVERLKSRLEEAHERRANYGVNGVAGSAAAAGGSSSGSANTTDYMAQSCGLVGINVPRQELLDLLLLEDVEGRPERMRVISIVGFGGSGKTTLARAVYDCPDIAGQFDGRAWVVASKHRDDTMGLLSALLGQIRQEDDQRFNQIPQDDEQRFQLQSQVQADIRQHLNAKRYLLVFDDIEEKQWNCIKSTFPTETRSRVLVTTTIKPVANACSHGTGSVYNMRTLNVNHSKDLLQSVLKEYSPELELDLPSILEKCDGLPLALVSVGNFLWRERITECYRNQVCCNLGHHIEKEHAFAELRQVLANNYNTLPGHPLKTCLLYTTVFPNGCSIRRSSLIRRWLAEGYVQCQYPRSSLEVADANLEELMDRNIIRSMDVTNNGRAKNCRAHGIMHEFMLHKSRCDNFIASLHDPDRSKCRHLFLTQSLTSGNQSYX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF268
4-435 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LSSVTNIVVGKLFALLEKKYEQWRGLEDSIGFIKRELRVIHGFLHDQLPRDRNGEDPPISAVQATCIDELRDLAHDIEDCLDRFLPCAACERDSSFLRRLAADSRFAGEVERLKSRLEEAHERRANYGVNGVAGSAAAAGGSSSGSANTTDYMAQSCGLVGINVPRQELLDLLLLEDVEGRPERMRVISIVGFGGSGKTTLARAVYDCPDIAGQFDGRAWVVASKHRDDTMGLLSALLGQIRQEDDQRFNQIPQDDEQRFQLQSQVQADIRQHLNAKRYLLVFDDIEEKQWNCIKSTFPTETRSRVLVTTTIKPVANACSHGTGSVYNMRTLNVNHSKDLLQSVLKEYSPELELDLPSILEKCDGLPLALVSVGNFLWRERITECYRNQVCCNLGHHIEKEHAFAELRQVLANNYNTLPGHPLKTCLLYTTV

HMMPanther: PTHR23155
4-435 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LSSVTNIVVGKLFALLEKKYEQWRGLEDSIGFIKRELRVIHGFLHDQLPRDRNGEDPPISAVQATCIDELRDLAHDIEDCLDRFLPCAACERDSSFLRRLAADSRFAGEVERLKSRLEEAHERRANYGVNGVAGSAAAAGGSSSGSANTTDYMAQSCGLVGINVPRQELLDLLLLEDVEGRPERMRVISIVGFGGSGKTTLARAVYDCPDIAGQFDGRAWVVASKHRDDTMGLLSALLGQIRQEDDQRFNQIPQDDEQRFQLQSQVQADIRQHLNAKRYLLVFDDIEEKQWNCIKSTFPTETRSRVLVTTTIKPVANACSHGTGSVYNMRTLNVNHSKDLLQSVLKEYSPELELDLPSILEKCDGLPLALVSVGNFLWRERITECYRNQVCCNLGHHIEKEHAFAELRQVLANNYNTLPGHPLKTCLLYTTV

Coil: coil
113-134 coiled-coil

VERLKSRLEEAHERRANYGVNG

Seg: seg
131-151 seg

GVNGVAGSAAAAGGSSSGSAN

superfamily: SSF52540
162-405 P-loop containing nucleoside triphosphate hydrolases

LVGINVPRQELLDLLLLEDVEGRPERMRVISIVGFGGSGKTTLARAVYDCPDIAGQFDGRAWVVASKHRDDTMGLLSALLGQIRQEDDQRFNQIPQDDEQRFQLQSQVQADIRQHLNAKRYLLVFDDIEEKQWNCIKSTFPTETRSRVLVTTTIKPVANACSHGTGSVYNMRTLNVNHSKDLLQSVLKEYSPELELDLPSILEKCDGLPLALVSVGNFLWRERITECYRNQVCCNLGHHIEKEH

Seg: seg
171-180 seg

ELLDLLLLED

Gene3D: G3DSA:3.40.50.300
174-207 no description

DLLLLEDVEGRPERMRVISIVGFGGSGKTTLARA

HMMPfam: PF00931
IPR002182
186-458 NB-ARC,NBS
NB-ARC

ERMRVISIVGFGGSGKTTLARAVYDCPDIAGQFDGRAWVVASKHRDDTMGLLSALLGQIRQEDDQRFNQIPQDDEQRFQLQSQVQADIRQHLNAKRYLLVFDDIEEKQWNCIKSTFPTETRSRVLVTTTIKPVANACSHGTGSVYNMRTLNVNHSKDLLQSVLKEYSPELELDLPSILEKCDGLPLALVSVGNFLWRERITECYRNQVCCNLGHHIEKEHAFAELRQVLANNYNTLPGHPLKTCLLYTTVFPNGCSIRRSSLIRRWLAEGYVQ

FPrintScan: PR00364
IPR000767
190-205 DISEASERSIST
Disease resistance protein

VISIVGFGGSGKTTLA

FPrintScan: PR00364
IPR000767
276-290 DISEASERSIST
Disease resistance protein

HLNAKRYLLVFDDIE

FPrintScan: PR00364
IPR000767
366-380 DISEASERSIST
Disease resistance protein

CDGLPLALVSVGNFL

Seg: seg
441-450 seg

SIRRSSLIRR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox