PRGDB00192582 (Os.102947)

From PRG Wiki
Jump to: navigation, search
Os.102947
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 336088128 (AB604617)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa

Comment?

Oryza sativa Japonica Group Os11gRGA3 mRNA for NBS-LRR type protein, partial cds, cultivar: Sasanishiki, Aichi-asahi

DNA Sequence

TGGTTCTTATGCAGCAATTGAAGCGACCATGGTTGCTAAATCCAAAATTTCTAATCTAATGGAGCTCTCAGCTACTGTGCAACGGATACGGAGGCAATTTTTGATGATGAACTTCTTTATACGGAAAATGGGTGCCTCTTACCTCAGCGATGAGCTCCTCAAGGGATGGATCGCAGAGGTGCGAATGCTGGCGTACCGTGTTGAGGATGTATTGGACAGCTTTTTCTACCATTCTATTCAATTCAAGAAAGATAAGTTCCTGAATAAGATTGTTAAGGGATCGCACTATGCTGTTGTTTTTAATGGAATTGCTGATGAGTTAATTCAAATAGAGAAGGATATTGAGCATGTTTCAAAGTTGAAGGACATGTGGGTGCACCCGGTCAGTCAGCTTATTCCTACTCAAGTCACCGTCTCTGAACAGCGATTTCCTCTGTACAATTTTCCCCAACTTATGAAAGATGAGGATCTTGTTGGGATGGACAACTACAGGCAACACTTAAAGCAATTACTCGGTCCCAAAATTCCAGCTCTCGGGGTGATATCTCTGTGGGGTATGGGTGGCATGGGAAAGACTACATTGGTCATTAATGTATATGAACATCATAAGGAGGAATTTGACATTAATGTGTGGCTCACTGTCTCTCAAGCATTTACTGTGGAGGCTTTGCTAAGAAAGCTATTATTGGAGATTCGTACCTGCAAACTCGCAATGGCTGATGGTCTTGTCAACCAGAGGCAGCAAGCTTCAAATGATATTGACAATTTGGGTGTTTCACAATTGAAGAGAGAGTTGCAGGAAGCACTGACACAAAAGAGATATTTGGTTGTATTTGATGATGTATGGGACCGTCGAGCTTATGATGGAATTCATGACGTGTTTGTGGATTGCAGGAATGGAAGTCGCATTGTGATCACGACAAGGAGAGGGGATGTGGCTGCTCTAGCTCACAAGGGTTGCCAGCTCAAACTTAATCCGTTAGAATTGAAGGATGCACTCCTTCTGTTCTGTAAAAAGGCATTTCCTAATAGCAATGACCTTGAGTACCCATTAAAGCTGCAGGAACTAGCCACAGACATTGCTAAGAAAAGCAAAGATTCATCCCTGACAGAGTGCCCATCGGAGCTAAAGGAGCTAGCTACTGATATTGCAAAGAAATGCAAGGGCTTGCCACTGGTGAATTACTCGCAACTTAAGGATCTAGCTCACGACATTGTAAAGAAATGTGATGAGTTATTGCTGGAAAAGTTGCCATCTGAGCGTCACGATCTAGCTACTAATATTGTAAATAAATGTAAGCTCTTTCCACTGGCGAAGTGCTCATCAGAGTTGCAGAAGATAGCTGTTGAGATTGTAAAGAAATGTGGGGGCCTTCCACTTGCAATTGCATCAATAGGTAGCTTGTTGTCTGCAAGGATGCAATTAGAGTGTGTGTGGAAGCAGATTTATGATCAACTTCCATGTGAGCTAGAGAAGGATGATCAGGTCCGAGGAGTTCTAACTTTGAGCTATTATGACTTGCCTGGAGAGCTCAGAAATTGTTTTTTGTACTGCAGCATGTTCCCAGAAGATTACCTTTTATCAAGGGAGGTTCTTGTGAAGCTATGGATTGCAGAAGGTTTTGTGGTAAAAAATGGGGACAGCACTCTGGAGGAGGTGGCAGAGGGATATCTCATGGAGCTGGTTCATCGAAACATGCTTCAACTTGTGCATAATGATGAGCTTGGCAGGGTTAGAATATGCAGGATGCATGACATTTTGAGAGAGTTGGCTCTTTCTATCTCCAAAGCAGAGTTGTTTGGTACCGCAAACAATTTTAGTGAAATGGTGCAGATGAACACAAATGTGCGTCGCCTGTCAGCATGTAGATGGAAGCAGACAAAACATGATGTATCAAAGATAAAATTCCCACATCTTCGAACCATGATCGCACTTGAATCATTTACGGACTTTGTACCATCAATGTTATCTGAATCTAAGCATCTTACTGTCCTTGAGCTCCAAGACTCAGTAATCGATGAAGTCCCACCATCTATAGGGGATCTTTTTAACTTGAGGTATATTGGCCTAAGGAACACAGCAGTAAAATGTCTACCGGACTCTATAGAGAAGCTCGTGAATCTTCAAACTCTTAATGCTAAGTCAACCAAGATAGAAAAATTACCTGGTGGGATTGTGAAGCTCTACAAGTTAAGACACCTACTGGCTGACAGATTAAGTGATGAGACAAGGATGGAATTCCGATATTTCTGTGGAGTGGAAGCACCAAAAGGGTTGTCAAGGTTAGAAGAACTGCAGACACTTGAGACTGTAGAAGCTAGCAAGGATTTGGGGGGGCAGCTCGAGAAAATGATCCAATTAAGAAACCTCTGGATTGACAATATAAAATATGAGCACTGCACAGAGCTGTTTGCTTCCTTGTCTAAGATGCCGCTTCTTTATAGCTTGCTTCTGTGTGCAAGTGATGAAAAAGAGAAGCTTAACATTGAAAATCTCATACCGACATCCACAATGCTCCAAAAGCTAATTATCAGAGGATGCACTGCTGAGAGGACACTTGATTGCCCGATGTTTCAGGACTATGGAGGAAACCTAAAGTACCTAGCTCTAAGTGGGTGTCACCTTGAGAACGATCCATTTGAAGCACTCGCGTCGTGCGTGCCAAACCTGACTTATTTGAGTCTTAACAAGGTTCATAGCAATAGTGCACAAACTTTGGTTCTTCCTGCACTGTCCTTTCCACTGCTGAAGACGCTTGTCTTGAGGAACATGTCTGATGTCAATGTTCTGAAAATTGAAGATGATGCCCTTCCATGTATCGAAGGTTTATACATTGTGTCACTGTCAAATCTGAAGAGCGTCCCTGAAGGCATTGAATGCCTTAGCTCCCTTAAGAAACTCACCCTTCTAGGCTTGCACAATGGAT


Protein sequences

Name Description Sequence
Os.102947 translated coding region predicted by ESTScan from UniGene Os.102947

XGSYAAIEATMVAKSKISNLMELSATVQRIRRQFLMMNFFIRKMGASYLSDELLKGWIAEVRMLAYRVEDVLDSFFYHSIQFKKDKFLNKIVKGSHYAVVFNGIADELIQIEKDIEHVSKLKDMWVHPVSQLIPTQVTVSEQRFPLYNFPQLMKDEDLVGMDNYRQHLKQLLGPKIPALGVISLWGMGGMGKTTLVINVYEHHKEEFDINVWLTVSQAFTVEALLRKLLLEIRTCKLAMADGLVNQRQQASNDIDNLGVSQLKRELQEALTQKRYLVVFDDVWDRRAYDGIHDVFVDCRNGSRIVITTRRGDVAALAHKGCQLKLNPLELKDALLLFCKKAFPNSNDLEYPLKLQELATDIAKKSKDSSLTECPSELKELATDIAKKCKGLPLVNYSQLKDLAHDIVKKCDELLLEKLPSERHDLATNIVNKCKLFPLAKCSSELQKIAVEIVKKCGGLPLAIASIGSLLSARMQLECVWKQIYDQLPCELEKDDQVRGVLTLSYYDLPGELRNCFLYCSMFPEDYLLSREVLVKLWIAEGFVVKNGDSTLEEVAEGYLMELVHRNMLQLVHNDELGRVRICRMHDILRELALSISKAELFGTANNFSEMVQMNTNVRRLSACRWKQTKHDVSKIKFPHLRTMIALESFTDFVPSMLSESKHLTVLELQDSVIDEVPPSIGDLFNLRYIGLRNTAVKCLPDSIEKLVNLQTLNAKSTKIEKLPGGIVKLYKLRHLLADRLSDETRMEFRYFCGVEAPKGLSRLEELQTLETVEASKDLGGQLEKMIQLRNLWIDNIKYEHCTELFASLSKMPLLYSLLLCASDEKEKLNIENLIPTSTMLQKLIIRGCTAERTLDCPMFQDYGGNLKYLALSGCHLENDPFEALASCVPNLTYLSLNKVHSNSAQTLVLPALSFPLLKTLVLRNMSDVNVLKIEDDALPCIEGLYIVSLSNLKSVPEGIECLSSLKKLTLLGLHNGX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-974 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

XGSYAAIEATMVAKSKISNLMELSATVQRIRRQFLMMNFFIRKMGASYLSDELLKGWIAEVRMLAYRVEDVLDSFFYHSIQFKKDKFLNKIVKGSHYAVVFNGIADELIQIEKDIEHVSKLKDMWVHPVSQLIPTQVTVSEQRFPLYNFPQLMKDEDLVGMDNYRQHLKQLLGPKIPALGVISLWGMGGMGKTTLVINVYEHHKEEFDINVWLTVSQAFTVEALLRKLLLEIRTCKLAMADGLVNQRQQASNDIDNLGVSQLKRELQEALTQKRYLVVFDDVWDRRAYDGIHDVFVDCRNGSRIVITTRRGDVAALAHKGCQLKLNPLELKDALLLFCKKAFPNSNDLEYPLKLQELATDIAKKSKDSSLTECPSELKELATDIAKKCKGLPLVNYSQLKDLAHDIVKKCDELLLEKLPSERHDLATNIVNKCKLFPLAKCSSELQKIAVEIVKKCGGLPLAIASIGSLLSARMQLECVWKQIYDQLPCELEKDDQVRGVLTLSYYDLPGELRNCFLYCSMFPEDYLLSREVLVKLWIAEGFVVKNGDSTLEEVAEGYLMELVHRNMLQLVHNDELGRVRICRMHDILRELALSISKAELFGTANNFSEMVQMNTNVRRLSACRWKQTKHDVSKIKFPHLRTMIALESFTDFVPSMLSESKHLTVLELQDSVIDEVPPSIGDLFNLRYIGLRNTAVKCLPDSIEKLVNLQTLNAKSTKIEKLPGGIVKLYKLRHLLADRLSDETRMEFRYFCGVEAPKGLSRLEELQTLETVEASKDLGGQLEKMIQLRNLWIDNIKYEHCTELFASLSKMPLLYSLLLCASDEKEKLNIENLIPTSTMLQKLIIRGCTAERTLDCPMFQDYGGNLKYLALSGCHLENDPFEALASCVPNLTYLSLNKVHSNSAQTLVLPALSFPLLKTLVLRNMSDVNVLKIEDDALPCIEGLYIVSLSNLKSVPEGIECLSSLKKLTLLGLH

HMMPanther: PTHR23155:SF195
1-974 OS11G0224900 PROTEIN,OS11G0224900 PROTEIN

XGSYAAIEATMVAKSKISNLMELSATVQRIRRQFLMMNFFIRKMGASYLSDELLKGWIAEVRMLAYRVEDVLDSFFYHSIQFKKDKFLNKIVKGSHYAVVFNGIADELIQIEKDIEHVSKLKDMWVHPVSQLIPTQVTVSEQRFPLYNFPQLMKDEDLVGMDNYRQHLKQLLGPKIPALGVISLWGMGGMGKTTLVINVYEHHKEEFDINVWLTVSQAFTVEALLRKLLLEIRTCKLAMADGLVNQRQQASNDIDNLGVSQLKRELQEALTQKRYLVVFDDVWDRRAYDGIHDVFVDCRNGSRIVITTRRGDVAALAHKGCQLKLNPLELKDALLLFCKKAFPNSNDLEYPLKLQELATDIAKKSKDSSLTECPSELKELATDIAKKCKGLPLVNYSQLKDLAHDIVKKCDELLLEKLPSERHDLATNIVNKCKLFPLAKCSSELQKIAVEIVKKCGGLPLAIASIGSLLSARMQLECVWKQIYDQLPCELEKDDQVRGVLTLSYYDLPGELRNCFLYCSMFPEDYLLSREVLVKLWIAEGFVVKNGDSTLEEVAEGYLMELVHRNMLQLVHNDELGRVRICRMHDILRELALSISKAELFGTANNFSEMVQMNTNVRRLSACRWKQTKHDVSKIKFPHLRTMIALESFTDFVPSMLSESKHLTVLELQDSVIDEVPPSIGDLFNLRYIGLRNTAVKCLPDSIEKLVNLQTLNAKSTKIEKLPGGIVKLYKLRHLLADRLSDETRMEFRYFCGVEAPKGLSRLEELQTLETVEASKDLGGQLEKMIQLRNLWIDNIKYEHCTELFASLSKMPLLYSLLLCASDEKEKLNIENLIPTSTMLQKLIIRGCTAERTLDCPMFQDYGGNLKYLALSGCHLENDPFEALASCVPNLTYLSLNKVHSNSAQTLVLPALSFPLLKTLVLRNMSDVNVLKIEDDALPCIEGLYIVSLSNLKSVPEGIECLSSLKKLTLLGLH

superfamily: SSF52540
138-395 P-loop containing nucleoside triphosphate hydrolases

TVSEQRFPLYNFPQLMKDEDLVGMDNYRQHLKQLLGPKIPALGVISLWGMGGMGKTTLVINVYEHHKEEFDINVWLTVSQAFTVEALLRKLLLEIRTCKLAMADGLVNQRQQASNDIDNLGVSQLKRELQEALTQKRYLVVFDDVWDRRAYDGIHDVFVDCRNGSRIVITTRRGDVAALAHKGCQLKLNPLELKDALLLFCKKAFPNSNDLEYPLKLQELATDIAKKSKDSSLTECPSELKELATDIAKKCKGLPLVN

Gene3D: G3DSA:3.40.50.300
150-282 no description

PQLMKDEDLVGMDNYRQHLKQLLGPKIPALGVISLWGMGGMGKTTLVINVYEHHKEEFDINVWLTVSQAFTVEALLRKLLLEIRTCKLAMADGLVNQRQQASNDIDNLGVSQLKRELQEALTQKRYLVVFDDV

HMMPfam: PF00931
IPR002182
168-366 NB-ARC,NBS
NB-ARC

LKQLLGPKIPALGVISLWGMGGMGKTTLVINVYEHHKEEFDINVWLTVSQAFTVEALLRKLLLEIRTCKLAMADGLVNQRQQASNDIDNLGVSQLKRELQEALTQKRYLVVFDDVWDRRAYDGIHDVFVDCRNGSRIVITTRRGDVAALAHKGCQLKLNPLELKDALLLFCKKAFPNSNDLEYPLKLQELATDIAKKSK

FPrintScan: PR00364
IPR000767
181-196 DISEASERSIST
Disease resistance protein

VISLWGMGGMGKTTLV

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

ALTQKRYLVVFDDVW

HMMPfam: PF00931
IPR002182
411-545 NB-ARC,NBS
NB-ARC

DELLLEKLPSERHDLATNIVNKCKLFPLAKCSSELQKIAVEIVKKCGGLPLAIASIGSLLSARMQLECVWKQIYDQLPCELEKDDQVRGVLTLSYYDLPGELRNCFLYCSMFPEDYLLSREVLVKLWIAEGFVVK

superfamily: SSF52540
440-494 P-loop containing nucleoside triphosphate hydrolases

KCSSELQKIAVEIVKKCGGLPLAIASIGSLLSARMQLECVWKQIYDQLPCELEKD

FPrintScan: PR00364
IPR000767
456-470 DISEASERSIST
Disease resistance protein

CGGLPLAIASIGSLL

superfamily: SSF52058
583-972 L domain-like,LRR

RMHDILRELALSISKAELFGTANNFSEMVQMNTNVRRLSACRWKQTKHDVSKIKFPHLRTMIALESFTDFVPSMLSESKHLTVLELQDSVIDEVPPSIGDLFNLRYIGLRNTAVKCLPDSIEKLVNLQTLNAKSTKIEKLPGGIVKLYKLRHLLADRLSDETRMEFRYFCGVEAPKGLSRLEELQTLETVEASKDLGGQLEKMIQLRNLWIDNIKYEHCTELFASLSKMPLLYSLLLCASDEKEKLNIENLIPTSTMLQKLIIRGCTAERTLDCPMFQDYGGNLKYLALSGCHLENDPFEALASCVPNLTYLSLNKVHSNSAQTLVLPALSFPLLKTLVLRNMSDVNVLKIEDDALPCIEGLYIVSLSNLKSVPEGIECLSSLKKLTLLG

Gene3D: G3DSA:3.80.10.10
651-737 no description

DFVPSMLSESKHLTVLELQDSVIDEVPPSIGDLFNLRYIGLRNTAVKCLPDSIEKLVNLQTLNAKSTKIEKLPGGIVKLYKLRHLLA

Gene3D: G3DSA:3.80.10.10
778-971 no description

LGGQLEKMIQLRNLWIDNIKYEHCTELFASLSKMPLLYSLLLCASDEKEKLNIENLIPTSTMLQKLIIRGCTAERTLDCPMFQDYGGNLKYLALSGCHLENDPFEALASCVPNLTYLSLNKVHSNSAQTLVLPALSFPLLKTLVLRNMSDVNVLKIEDDALPCIEGLYIVSLSNLKSVPEGIECLSSLKKLTLL

Seg: seg
807-819 seg

SLSKMPLLYSLLL

Seg: seg
962-973 seg

LSSLKKLTLLGL

FPrintScan: PR00364
IPR000767
963-977 DISEASERSIST
Disease resistance protein

SSLKKLTLLGLHNGX






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox