PRGDB00192862 (Ta.6296)

From PRG Wiki
Jump to: navigation, search
Ta.6296
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 20047225 (BJ226439)
Gene Class Unknown
Domain Type LRR
Gene Species Triticum aestivum

Comment?

BJ226439 Y. Ogihara unpublished cDNA library, Wh_dL Triticum aestivum cDNA clone whdl26i02 5', mRNA sequence

DNA Sequence

AGGAATTCGGCACGAGGTAAAGGGTGATTTGGTTAAGCATGGGTGGCTGAAGGTCTGATTTATACAACAGAAGGGCAAGACATTGAGAAAGTTGCAGAAAGCTATTTATATCAGCTTATTGGTAGAAGCTTCATCCAGCCGATGTGTGTCAACTACTACAATGAGGTGTTGTCCTGTCAAGTGCATGACATGGTACATGATCTTATTGCACACAAATCTGCAGAAGAGAATTTCATGGTGGCAATAGACTACAGATGTCAAAAGAATGTGTCACTTTCTCATAAGGCCCGTCGACTCTCGCTCATATTTGGTGATGCGAGATATGCCAAGACACCAGCAAACATCCGAAAATCGCTAGTTCGGTCAGTTAGATTCTCTGGATTGCTTGAGTCTATGCCTTGTCTTACAGAGTTCAAGCTTGTTCGTGTCCTAAACCTTCAACTAAGTGGTCAAGGCCGCCGTGATAATGATATGGCAGACCTCACTGGGATTTCAGAAATGTTTCAGCTGAGATATTTGAAGATTGCAAGCGATGTCTGCATCAAACTGCCGGACCATGTACTACAGTGCCTGGGTACATTGGATATTACCGATGCAAGATTTGCTCCTGTTCCATGGGATGTGAATTTCCCACGCTTGCTGCACTTGCACCTTAGTCTTCCTGTCGAGAGAGATC


Protein sequences

Name Description Sequence
Ta.6296 translated coding region predicted by ESTScan from UniGene Ta.6296

XGIRHEVKGDLVKXWVAEGLIYTTEGQDIEKVAESYLYQLIGRSFIQPMCVNYYNEVLSCQVHDMVHDLIAHKSAEENFMVAIDYRCQKNVSLSHKARRLSLIFGDARYAKTPANIRKSLVRSVRFSGLLESMPCLTEFKLVRVLNLQLSGQGRRDNDMADLTGISEMFQLRYLKIASDVCIKLPDHVLQCLGTLDITDARFAPVPWDVNFPRLLHLHLSLPVERDX

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
45-220 L domain-like,LRR

FIQPMCVNYYNEVLSCQVHDMVHDLIAHKSAEENFMVAIDYRCQKNVSLSHKARRLSLIFGDARYAKTPANIRKSLVRSVRFSGLLESMPCLTEFKLVRVLNLQLSGQGRRDNDMADLTGISEMFQLRYLKIASDVCIKLPDHVLQCLGTLDITDARFAPVPWDVNFPRLLHLHLS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox