PRGDB00192867 (Ta.6827)

From PRG Wiki
Jump to: navigation, search
Ta.6827
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 19953109 (BJ213536)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Triticum aestivum

Comment?

BJ213536 Y. Ogihara unpublished cDNA library, Wh Triticum aestivum cDNA clone wh22p17 5', mRNA sequence

DNA Sequence

AATTCTTATNCCCTGTATTCTTCGTACAGTTACAATGAGCTTGCAGATATCACTTCTAATTTTTCATCTGAGTGTATAATTGGACAAGGTGGCACGAGCCAAGTCTATAAAGGTTGTTTGACAAATGGCAAGGAGTTGGCAGTGAAGATCCTGAAGTATTCCGATGAGGTACTGAAGGAGTTCACATCAGAGATCGAGATTGTCAGCTCCGTCGTTCACAAGAACGTCATATCCATCACTGGCTTCTCCTTCAAGAACAATGATCTTCTATTGGTATATGAATACTTGCAAAGAGGCAGCCTAGAAGAAATACTGCATGGCGAGAAAGAATGTAAAAGCATGTTTGGTTGGACCGAGAGGTTCAATGTGGCGGTAGGTGTTGCTCATGCACTGGATTATCTCCATGGTAACGGCAACAGTCGCCCAGTGATCCATAGGGATGTCAAGTCGTCAAATATCCTCGTCTCAGAGGATTTTGAGCCAAAGTTATCAGACTTTGGCCTTGCGCTTTGGGCCGCTGATGCAACACCCCAGATCACATGCAATGATGTAGCAGGAACTTTTGGGTACTTGGCTCCTGAATACTTCATGCATGGCAAGGTGAACGACAAAATCGATGTTTTCGCTTTTGGTGTTGTTCTTCTTGAACTCGTCTCAGGCAGGAAACCGCTGTGCACTGGTTGTCCGAA


Protein sequences

Name Description Sequence
Ta.6827 translated coding region predicted by ESTScan from UniGene Ta.6827

NSYXLYSSYSYNELADITSNFSSECIIGQGGTSQVYKGCLTNGKELAVKILKYSDEVLKEFTSEIEIVSSVVHKNVISITGFSFKNNDLLLVYEYLQRGSLEEILHGEKECKSMFGWTERFNVAVGVAHALDYLHGNGNSRPVIHRDVKSSNILVSEDFEPKLSDFGLALWAADATPQITCNDVAGTFGYLAPEYFMHGKVNDKIDVFAFGVVLLELVSGRKPLCTGCPX

Domains

Domain Start-End Description Sequence

Seg: seg
2-11 seg

SYXLYSSYSY

HMMPanther: PTHR24420
6-229 FAMILY NOT NAMED,FAMILY NOT NAMED

YSSYSYNELADITSNFSSECIIGQGGTSQVYKGCLTNGKELAVKILKYSDEVLKEFTSEIEIVSSVVHKNVISITGFSFKNNDLLLVYEYLQRGSLEEILHGEKECKSMFGWTERFNVAVGVAHALDYLHGNGNSRPVIHRDVKSSNILVSEDFEPKLSDFGLALWAADATPQITCNDVAGTFGYLAPEYFMHGKVNDKIDVFAFGVVLLELVSGRKPLCTGCP

HMMPanther: PTHR24420:SF425
6-229 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

YSSYSYNELADITSNFSSECIIGQGGTSQVYKGCLTNGKELAVKILKYSDEVLKEFTSEIEIVSSVVHKNVISITGFSFKNNDLLLVYEYLQRGSLEEILHGEKECKSMFGWTERFNVAVGVAHALDYLHGNGNSRPVIHRDVKSSNILVSEDFEPKLSDFGLALWAADATPQITCNDVAGTFGYLAPEYFMHGKVNDKIDVFAFGVVLLELVSGRKPLCTGCP

Gene3D: G3DSA:3.30.200.20
7-81 no description

SSYSYNELADITSNFSSECIIGQGGTSQVYKGCLTNGKELAVKILKYSDEVLKEFTSEIEIVSSVVHKNVISITG

superfamily: SSF56112
IPR011009
7-223 Protein kinase-like (PK-like)
Protein kinase-like domain

SSYSYNELADITSNFSSECIIGQGGTSQVYKGCLTNGKELAVKILKYSDEVLKEFTSEIEIVSSVVHKNVISITGFSFKNNDLLLVYEYLQRGSLEEILHGEKECKSMFGWTERFNVAVGVAHALDYLHGNGNSRPVIHRDVKSSNILVSEDFEPKLSDFGLALWAADATPQITCNDVAGTFGYLAPEYFMHGKVNDKIDVFAFGVVLLELVSGRKP

HMMSmart: SM00219
IPR020635
21-230 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSSECIIGQGGTSQVYKGCLTNGKELAVKILKYSDEVLKEFTSEIEIVSSVVHKNVISITGFSFKNNDLLLVYEYLQRGSLEEILHGEKECKSMFGWTERFNVAVGVAHALDYLHGNGNSRPVIHRDVKSSNILVSEDFEPKLSDFGLALWAADATPQITCNDVAGTFGYLAPEYFMHGKVNDKIDVFAFGVVLLELVSGRKPLCTGCPX

ProfileScan: PS50011
IPR000719
21-230 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSECIIGQGGTSQVYKGCLTNGKELAVKILKYSDEVLKEFTSEIEIVSSVVHKNVISITGFSFKNNDLLLVYEYLQRGSLEEILHGEKECKSMFGWTERFNVAVGVAHALDYLHGNGNSRPVIHRDVKSSNILVSEDFEPKLSDFGLALWAADATPQITCNDVAGTFGYLAPEYFMHGKVNDKIDVFAFGVVLLELVSGRKPLCTGCPX

HMMSmart: SM00220
IPR002290
21-230 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSSECIIGQGGTSQVYKGCLTNGKELAVKILKYSDEVLKEFTSEIEIVSSVVHKNVISITGFSFKNNDLLLVYEYLQRGSLEEILHGEKECKSMFGWTERFNVAVGVAHALDYLHGNGNSRPVIHRDVKSSNILVSEDFEPKLSDFGLALWAADATPQITCNDVAGTFGYLAPEYFMHGKVNDKIDVFAFGVVLLELVSGRKPLCTGCPX

HMMPfam: PF00069
IPR000719
26-224 Pkinase,Ser-thr
Protein kinase, catalytic domain

IIGQGGTSQVYKGCLTNGKELAVKILKYSDEVLKEFTSEIEIVSSVVHKNVISITGFSFKNNDLLLVYEYLQRGSLEEILHGEKECKSMFGWTERFNVAVGVAHALDYLHGNGNSRPVIHRDVKSSNILVSEDFEPKLSDFGLALWAADATPQITCNDVAGTFGYLAPEYFMHGKVNDKIDVFAFGVVLLELVSGRKPL

PatternScan: PS00107
IPR017441
27-49 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGQGGTSQVYKGCLTNGKELAVK

Gene3D: G3DSA:1.10.510.10
82-224 no description

FSFKNNDLLLVYEYLQRGSLEEILHGEKECKSMFGWTERFNVAVGVAHALDYLHGNGNSRPVIHRDVKSSNILVSEDFEPKLSDFGLALWAADATPQITCNDVAGTFGYLAPEYFMHGKVNDKIDVFAFGVVLLELVSGRKPL

PatternScan: PS00108
IPR008271
143-155 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKSSNILV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox