PRGDB00192923 (Ta.25608)

From PRG Wiki
Jump to: navigation, search
Ta.25608
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 55599163 (CV760166)
Gene Class Unknown
Domain Type LRR
Gene Species Triticum aestivum

Comment?

FGAS054550 Triticum aestivum FGAS: Library 2 Gate 3 Triticum aestivum cDNA, mRNA sequence

DNA Sequence

ctagcattaggtgacctatagaaaagtttgtacaaaaaagcaggctggtaccggtccggaattcccgggatatcgtcgacCCACGCGTCCGATAACCTGCTGCTCCTTAGCAAGCTAGAGGCACTGTTCTCCCTCACCTTCTCATTCAGGGCAGAAAAGCAGGATTCGGAAACACTGACCATTCTGGCAGAAAACAAGCTGTGCTCTGATGGGGAGATCACAATTCCAGATGCTGGTTTTAAGAGCCTTAAGCTTCTTCGCTTCTTTGCTCCTCTCTTGCCAGTACTGACCTTTTCGAAGAATGCCATGCCAGAGCTGGAGAGGCTTGAGCTACGGTTCAGCATGCTGGAGGGGCTTTATGGCGTGGAAAACCTTGCGGGACTCAAGGTGGTGCACCTGACGTTGAAGGACAAAGACGGTGAATATATGACGAAAGAGGTGCAGCATGAGGTAGAGACAGCAGTGAAGAGGAGGACCGATGGCAAGGCGCCCAAGATAATCCTTGATCAGTGACTGATCCAAAGTGAGAGCCCAACGGTGTTTCTTTGCAAGTCTGTAAGTTGAAAATCACTATGGTGCTTTACTTACTCAGAAGGATGATACTGTCaaaaccaaaaaaaGATGAGGCTTCATCCAGGTACATCATGTGAGTGTTAATGTGATTTTCTTTTCTGCTAAGCTTTTGTGTGCTGCAAGTTTGATCATCGGCGACATGGTCTCTTTTTCTAGGGCAATGTATTGTAAATTCATGTAAGAAAAATGTGTTGTAACTTTCATGTAAGACAATGACCATGTATTTATGCGTATTCATCTCTGATACCCGGAGGTATGAATTGTCAACATTTTTGTAATGAAGGTTCA


Protein sequences

Name Description Sequence
Ta.25608 translated coding region predicted by ESTScan from UniGene Ta.25608

LALGDLXKSLYKKAGWYRSGIPGISSTHASDNLLLLSKLEALFSLTFSFRAEKQDSETLTILAENKLCSDGEITIPDAGFKSLKLLRFFAPLLPVLTFSKNAMPELERLELRFSMLEGLYGVENLAGLKVVHLTLKDKDGEYMTKEVQHEVETAVKRRTDGKAPKIILDQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
24-133 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ISSTHASDNLLLLSKLEALFSLTFSFRAEKQDSETLTILAENKLCSDGEITIPDAGFKSLKLLRFFAPLLPVLTFSKNAMPELERLELRFSMLEGLYGVENLAGLKVVHL

HMMPanther: PTHR23155:SF219
24-133 OS11G0688000 PROTEIN,OS11G0688000 PROTEIN

ISSTHASDNLLLLSKLEALFSLTFSFRAEKQDSETLTILAENKLCSDGEITIPDAGFKSLKLLRFFAPLLPVLTFSKNAMPELERLELRFSMLEGLYGVENLAGLKVVHL

Seg: seg
30-45 seg

SDNLLLLSKLEALFSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox