PRGDB00193241 (Ta.75820)

From PRG Wiki
Jump to: navigation, search
Ta.75820
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 70960267 (DR733463)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

FGAS079221 Triticum aestivum FGAS: Library 2 Gate 3 Triticum aestivum cDNA, mRNA sequence

DNA Sequence

acgctatgaccttaggcctatttaggtgacactctagaacaagtttgtacaaaaaagcaggctggtaccggtccggaattcccgggatatcgtcgacCCACGCGTCCGCAGATTCTTGATAAAGGCACTTGGTAGGAAAAGATTTGTAATCCTGCTTGATGATGTAAGGAAGAAATTCTGTCTGGAGGACGTTGGTATCCCAACTCCAGATATCAACAGTCAGAGCAAGCTGATCCTCACATCACGTTACCGAGAAGTATGCTTCCAGATGAATGCACAAAGAAGCTTGATTGAGATGCAGATTTTGGGTAATGATGCTTCATGGGAACTCTTCTTGAGCAAGCTGAGCACGGAAACTAGTGCAGCAGTTGAACCGCTTGGTTCCCAGAGTGCTACTAGAGAGCACGCTATGAAAATAGCCCAAAGTTGTGGAGGCCTACCACTTGCACTCAATGTCATTGGGACTGCTGTGGCAGGCTTGGAAGAGGGAGAGTGGCAATCAGCTGCGGATGCAATTGCTACCAATATGGACAATATTGATGGCGTGGATGAAATGTTTGGTCGGTTAAAGTACAGCTTCGACAGGCTCACACCCACTCAACAACAGTGTTTCCTATACTGCACACTTTTTCCAGAATATGGATCTATTAGTAAAGAGCAACTTATTGGTTACTGGTTAGCTGAAGGTTTGCTATTAAATGATTCTGAAAAGGGTTATCAGATAATCCGCAGTCTTGTTTCAGCTTGCTTGTTGCAGGTCAGTGGCTCAATGTCTTCAAGGTAAAAATGCACCATGTAATTANGCAACTGGGGCTATGGTTGGTCACAAGTCAGAT


Protein sequences

Name Description Sequence
Ta.75820 translated coding region predicted by ESTScan from UniGene Ta.75820

XRYDLRPIXVTLXNKFVQKSRLVPVRNSRDIVDPRVRRFLIKALGRKRFVILLDDVRKKFCLEDVGIPTPDINSQSKLILTSRYREVCFQMNAQRSLIEMQILGNDASWELFLSKLSTETSAAVEPLGSQSATREHAMKIAQSCGGLPLALNVIGTAVAGLEEGEWQSAADAIATNMDNIDGVDEMFGRLKYSFDRLTPTQQQCFLYCTLFPEYGSISKEQLIGYWLAEGLLLNDSEKGYQKSAVLFQLACCRSVAQCLQGKNAPCNXATGAMVGHKSD

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
35-173 P-loop containing nucleoside triphosphate hydrolases

RVRRFLIKALGRKRFVILLDDVRKKFCLEDVGIPTPDINSQSKLILTSRYREVCFQMNAQRSLIEMQILGNDASWELFLSKLSTETSAAVEPLGSQSATREHAMKIAQSCGGLPLALNVIGTAVAGLEEGEWQSAADAI

HMMPfam: PF00931
IPR002182
35-232 NB-ARC,NBS
NB-ARC

RVRRFLIKALGRKRFVILLDDVRKKFCLEDVGIPTPDINSQSKLILTSRYREVCFQMNAQRSLIEMQILGNDASWELFLSKLSTETSAAVEPLGSQSATREHAMKIAQSCGGLPLALNVIGTAVAGLEEGEWQSAADAIATNMDNIDGVDEMFGRLKYSFDRLTPTQQQCFLYCTLFPEYGSISKEQLIGYWLAEGLL

FPrintScan: PR00364
IPR000767
43-57 DISEASERSIST
Disease resistance protein

ALGRKRFVILLDDVR

HMMPanther: PTHR11017
44-230 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LGRKRFVILLDDVRKKFCLEDVGIPTPDINSQSKLILTSRYREVCFQMNAQRSLIEMQILGNDASWELFLSKLSTETSAAVEPLGSQSATREHAMKIAQSCGGLPLALNVIGTAVAGLEEGEWQSAADAIATNMDNIDGVDEMFGRLKYSFDRLTPTQQQCFLYCTLFPEYGSISKEQLIGYWLAEG

HMMPanther: PTHR11017:SF20
44-230 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LGRKRFVILLDDVRKKFCLEDVGIPTPDINSQSKLILTSRYREVCFQMNAQRSLIEMQILGNDASWELFLSKLSTETSAAVEPLGSQSATREHAMKIAQSCGGLPLALNVIGTAVAGLEEGEWQSAADAIATNMDNIDGVDEMFGRLKYSFDRLTPTQQQCFLYCTLFPEYGSISKEQLIGYWLAEG

FPrintScan: PR00364
IPR000767
144-158 DISEASERSIST
Disease resistance protein

CGGLPLALNVIGTAV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox