PRGDB00193244 (Ta.75878)

From PRG Wiki
Jump to: navigation, search
Ta.75878
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 70959515 (DR732713)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Triticum aestivum

Comment?

FGAS078633 Triticum aestivum FGAS: TaLt5 Triticum aestivum cDNA, mRNA sequence

DNA Sequence

ccacacgctcctgctatagattacgccccgctattgttgtgatcactatagaatactcaagctatgcatccaacgcgttgggagctctcccatatggtcgacctgcaggcggccgcactagtgatttcgagcggccgcccgggcaggtTGGTATCAACGCAGAGCCCACGGACCTGCCGTTATCACTTTTGGAGGACATCACGGATCGTTTCTCCCTGATCAGGAAATTGGCAGCGGTGGATTCGCCGTGGTTTACAAGGGAATGATCGGAAAACGGACGGTTGCTGTAAAGAAGCTGTCAAACACAGTTGATATTACTGAGAGTAAATTCCACAGAGAGGTTAAATGCTTAATGAAGACCAAGCACAAGAACATAGTACGTTTTCTGGGGTATTGTGCTGACACACAAGGAAAAATGGCAGAATATGAGGGGAAGCTTGTCATGGCAGATGTACGAAACTGGTTACTCTGTTTTGAGTTTGTACCCAAAGGGAGTCTTGAGAAGCATATGTCTGATGCATCTTGCGGACTTGAATGGAGAGAGCGCTATCGAATAATTAGGGGAATATGTGAAGGCTTACATTACCTTCATGAGAAGCGCATTCTTCATTTGGACCTTAAGCCTGCTAATGTCCTGCTTGAGATTGGCATGGTACCCCAAATTGCTGATTTTGGTCTCTCGCGGNTGTTTTGATGAANGGCAAACCCGAGCTGTTCTCAACATCTGTGTGGATCTCAGGGGGTACTTGGCTCAAGAAATCTATAGAGGGGCAATCGCATTCGCGTCAGACATATATAGTCTTGGTGTTATTATCATGGAGATACTGACAGGAACAAAGGGATATTTTGAGGAGGAGAACCCAAACGATCTTCCACCAGCAGAAAAA


Protein sequences

Name Description Sequence
Ta.75878 translated coding region predicted by ESTScan from UniGene Ta.75878

XTRSCYRLRPAIVVITIEYSSYASNALGALPYGRPAGGRTSDFERPPGQVGINAEPTGPAVITFGGHHGSFLPDQEIGSGGFAVVYKGMIGKRTVAVKKLSNTVDITESKFHREVKCLMKTKHKNIVRFLGYCADTQGKMAEYEGKLVMADVRNWLLCFEFVPKGSLEKHMSDASCGLEWRERYRIIRGICEGLHYLHEKRILHLDLKPANVLLEIGMVPQIADFGLSGCFDEXQTRAVLNICVDLRGYLAQEIYRGAIAFASDIYSLGVIIMEILTGTKGYFEEENPNDLPPAEK

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
41-287 Protein kinase-like (PK-like)
Protein kinase-like domain

SDFERPPGQVGINAEPTGPAVITFGGHHGSFLPDQEIGSGGFAVVYKGMIGKRTVAVKKLSNTVDITESKFHREVKCLMKTKHKNIVRFLGYCADTQGKMAEYEGKLVMADVRNWLLCFEFVPKGSLEKHMSDASCGLEWRERYRIIRGICEGLHYLHEKRILHLDLKPANVLLEIGMVPQIADFGLSGCFDEXQTRAVLNICVDLRGYLAQEIYRGAIAFASDIYSLGVIIMEILTGTKGYFEEEN

HMMPanther: PTHR24420:SF762
71-280 OS10G0200000 PROTEIN

FLPDQEIGSGGFAVVYKGMIGKRTVAVKKLSNTVDITESKFHREVKCLMKTKHKNIVRFLGYCADTQGKMAEYEGKLVMADVRNWLLCFEFVPKGSLEKHMSDASCGLEWRERYRIIRGICEGLHYLHEKRILHLDLKPANVLLEIGMVPQIADFGLSGCFDEXQTRAVLNICVDLRGYLAQEIYRGAIAFASDIYSLGVIIMEILTGTK

HMMPanther: PTHR24420
71-280 FAMILY NOT NAMED,FAMILY NOT NAMED

FLPDQEIGSGGFAVVYKGMIGKRTVAVKKLSNTVDITESKFHREVKCLMKTKHKNIVRFLGYCADTQGKMAEYEGKLVMADVRNWLLCFEFVPKGSLEKHMSDASCGLEWRERYRIIRGICEGLHYLHEKRILHLDLKPANVLLEIGMVPQIADFGLSGCFDEXQTRAVLNICVDLRGYLAQEIYRGAIAFASDIYSLGVIIMEILTGTK

HMMSmart: SM00219
IPR020635
71-296 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FLPDQEIGSGGFAVVYKGMIGKRTVAVKKLSNTVDITESKFHREVKCLMKTKHKNIVRFLGYCADTQGKMAEYEGKLVMADVRNWLLCFEFVPKGSLEKHMSDASCGLEWRERYRIIRGICEGLHYLHEKRILHLDLKPANVLLEIGMVPQIADFGLSGCFDEXQTRAVLNICVDLRGYLAQEIYRGAIAFASDIYSLGVIIMEILTGTKGYFEEENPNDLPPAEK

HMMSmart: SM00220
IPR002290
71-294 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FLPDQEIGSGGFAVVYKGMIGKRTVAVKKLSNTVDITESKFHREVKCLMKTKHKNIVRFLGYCADTQGKMAEYEGKLVMADVRNWLLCFEFVPKGSLEKHMSDASCGLEWRERYRIIRGICEGLHYLHEKRILHLDLKPANVLLEIGMVPQIADFGLSGCFDEXQTRAVLNICVDLRGYLAQEIYRGAIAFASDIYSLGVIIMEILTGTKGYFEEENPNDLPPA

ProfileScan: PS50011
IPR000719
71-296 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FLPDQEIGSGGFAVVYKGMIGKRTVAVKKLSNTVDITESKFHREVKCLMKTKHKNIVRFLGYCADTQGKMAEYEGKLVMADVRNWLLCFEFVPKGSLEKHMSDASCGLEWRERYRIIRGICEGLHYLHEKRILHLDLKPANVLLEIGMVPQIADFGLSGCFDEXQTRAVLNICVDLRGYLAQEIYRGAIAFASDIYSLGVIIMEILTGTKGYFEEENPNDLPPAEK

Gene3D: G3DSA:3.30.200.20
73-129 no description

PDQEIGSGGFAVVYKGMIGKRTVAVKKLSNTVDITESKFHREVKCLMKTKHKNIVRF

HMMPfam: PF00069
IPR000719
75-286 Pkinase,Ser-thr
Protein kinase, catalytic domain

QEIGSGGFAVVYKGMIGKRTVAVKKLSNTVDITESKFHREVKCLMKTKHKNIVRFLGYCADTQGKMAEYEGKLVMADVRNWLLCFEFVPKGSLEKHMSDASCGLEWRERYRIIRGICEGLHYLHEKRILHLDLKPANVLLEIGMVPQIADFGLSGCFDEXQTRAVLNICVDLRGYLAQEIYRGAIAFASDIYSLGVIIMEILTGTKGYFEEE

PatternScan: PS00107
IPR017441
77-99 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGGFAVVYKGMIGKRTVAVKK

Gene3D: G3DSA:1.10.510.10
130-287 no description

LGYCADTQGKMAEYEGKLVMADVRNWLLCFEFVPKGSLEKHMSDASCGLEWRERYRIIRGICEGLHYLHEKRILHLDLKPANVLLEIGMVPQIADFGLSGCFDEXQTRAVLNICVDLRGYLAQEIYRGAIAFASDIYSLGVIIMEILTGTKGYFEEEN

PatternScan: PS00108
IPR008271
202-214 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHLDLKPANVLL

ProfileScan: PS50096
IPR000048
235-264 IQ
IQ motif, EF-hand binding site

QTRAVLNICVDLRGYLAQEIYRGAIAFASD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox