PRGDB00193277 (Ta.76999)

From PRG Wiki
Jump to: navigation, search
Ta.76999
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 70959909 (DR733105)
Gene Class Unknown
Domain Type LRR
Gene Species Triticum aestivum

Comment?

FGAS077360 Triticum aestivum FGAS: TaLt7 Triticum aestivum cDNA, mRNA sequence

DNA Sequence

tatgctccaacgcgttgccagctcgctatatggtcgacctgcaggcggccgcactagtgattagcgtggtcgcggccgaggtTCTGAGCAGATCACACAAAGATATTAAGGAGTTGCAACAGGTATTGGCATCACTAAGAGCATTGGATTGCTCCCCTTCTCTAATTGTCATTTGCAAGGCCATAAATGCAAAACATTTACGGTATCTTGACCTCTCTTGGTCAGACATCATTAGTTTGCCAGATTCAGTATGTATGTTGTATAATCTGCAAACACTGAGGCTCATAGGTTGTCAAAAGTTGCAGCAGTTACCACAAAACATGGCAAGATTGAGAAAGCTCATCCATCTTTATCTATCTGGTTGTGATCGTCTCAGAAGTATGTCCCCAAATTTTGGTGTACTGAACAACCTTCACATATTAACAACATTTGTTGTGGGTACTGGATATGGTCTCGGGATAGAGCAGCTCAAAGACTTGCAACACCTGAGCAATAGGCTGGAACTGCTGAATTTGAGCAAGATAAGGAGTGGCAAGAATGCAAAAGAAGCCAACCTCAATCAGAAGCAAAATCTAACTGAGTTGTTATTCTCTTGGGACCAAAAAGTAGGTGATGGGCCTAGAGATATGGCCTGCAATGTGGAAGAAGTGTTGCAGTGTTTAGAACCTCACAGTAATATCCAAAATTTGGAGATACGTGGATATGGCGGCCTAGGAATATCACAATGGATGAGAAAGCCTCAGATGTTTAACAGTTTGAAAGAACTCGAAATGTCCGATTGCCCAAGATGCAAGAGTATACCCGTCGTATGGTTCTCGGTCACTCTGGAGATTTTGTCCTTACAAAAGATGGATAACCTGACCACATTATGTAATAACCTTGATGTTGAAGCCAGAGGATGCATTACCCCTCTGCCCAATTTCCCTGGGTTGAAGAGGATGGAGTTGATTGATTTACCAAGCCTGGAGATATGGGCAGAAATATTGTGGGAGAGCTAGTGATAGCTTGTTACGTTCCCGATGCTTGAGAGCTAAGATCGAAAGTGCCNTAGCTTGCCAGTATCCAATGACCCCAATTCAGCGATTGAAATAGTTAAGTCCAAGACTAAGTCCAGTTATTTTATAACATCAATGGGCCCTTGCCATTTCCCCAAGTAACTTTCGGTCCACGAAAATACCATTTGCTCTTAACACCCAT


Protein sequences

Name Description Sequence
Ta.76999 translated coding region predicted by ESTScan from UniGene Ta.76999

XCSNALPARYMVDLQAAALVISVVAAEVLSRSHKDIKELQQVLASLRALDCSPSLIVICKAINAKHLRYLDLSWSDIISLPDSVCMLYNLQTLRLIGCQKLQQLPQNMARLRKLIHLYLSGCDRLRSMSPNFGVLNNLHILTTFVVGTGYGLGIEQLKDLQHLSNRLELLNLSKIRSGKNAKEANLNQKQNLTELLFSWDQKVGDGPRDMACNVEEVLQCLEPHSNIQNLEIRGYGGLGISQWMRKPQMFNSLKELEMSDCPRCKSIPVVWFSVTLEILSLQKMDNLTTLCNNLDVEARGCITPLPNFPGLKRMELIDLPSLEIWAEILWESXXXLVTFPMLES


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
19-273 L domain-like,LRR

LVISVVAAEVLSRSHKDIKELQQVLASLRALDCSPSLIVICKAINAKHLRYLDLSWSDIISLPDSVCMLYNLQTLRLIGCQKLQQLPQNMARLRKLIHLYLSGCDRLRSMSPNFGVLNNLHILTTFVVGTGYGLGIEQLKDLQHLSNRLELLNLSKIRSGKNAKEANLNQKQNLTELLFSWDQKVGDGPRDMACNVEEVLQCLEPHSNIQNLEIRGYGGLGISQWMRKPQMFNSLKELEMSDCPRCKSIPVVWFS

Gene3D: G3DSA:3.80.10.10
29-282 no description

LSRSHKDIKELQQVLASLRALDCSPSLIVICKAINAKHLRYLDLSWSDIISLPDSVCMLYNLQTLRLIGCQKLQQLPQNMARLRKLIHLYLSGCDRLRSMSPNFGVLNNLHILTTFVVGTGYGLGIEQLKDLQHLSNRLELLNLSKIRSGKNAKEANLNQKQNLTELLFSWDQKVGDGPRDMACNVEEVLQCLEPHSNIQNLEIRGYGGLGISQWMRKPQMFNSLKELEMSDCPRCKSIPVVWFSVTLEILSLQ

HMMPanther: PTHR23155
38-319 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ELQQVLASLRALDCSPSLIVICKAINAKHLRYLDLSWSDIISLPDSVCMLYNLQTLRLIGCQKLQQLPQNMARLRKLIHLYLSGCDRLRSMSPNFGVLNNLHILTTFVVGTGYGLGIEQLKDLQHLSNRLELLNLSKIRSGKNAKEANLNQKQNLTELLFSWDQKVGDGPRDMACNVEEVLQCLEPHSNIQNLEIRGYGGLGISQWMRKPQMFNSLKELEMSDCPRCKSIPVVWFSVTLEILSLQKMDNLTTLCNNLDVEARGCITPLPNFPGLKRMELIDL

HMMPanther: PTHR23155:SF182
38-319 OS08G0543500 PROTEIN,OS08G0543500 PROTEIN

ELQQVLASLRALDCSPSLIVICKAINAKHLRYLDLSWSDIISLPDSVCMLYNLQTLRLIGCQKLQQLPQNMARLRKLIHLYLSGCDRLRSMSPNFGVLNNLHILTTFVVGTGYGLGIEQLKDLQHLSNRLELLNLSKIRSGKNAKEANLNQKQNLTELLFSWDQKVGDGPRDMACNVEEVLQCLEPHSNIQNLEIRGYGGLGISQWMRKPQMFNSLKELEMSDCPRCKSIPVVWFSVTLEILSLQKMDNLTTLCNNLDVEARGCITPLPNFPGLKRMELIDL

HMMPfam: PF00560
IPR001611
113-134 LRR_1
Leucine-rich repeat

KLIHLYLSGCDRLRSMSPNFGV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox