PRGDB00193911 (Aan.94001)

From PRG Wiki
Jump to: navigation, search
Aan.94001
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 159632326 (EY090940)
Gene Class Unknown
Domain Type
Gene Species Artemisia annua

Comment?

CAZI19632.fwd CAZI Artemisia annua normalized leaf library Artemisia annua cDNA clone CAZI19632 5', mRNA sequence

DNA Sequence

GAGCTAGTGGCAAACCCGGCCATTATATTTATGGATGAGCCAACCTCTGGTCTAGATGCTAGAGCTGCTGCCATTGTGATGAGAACCGTTAGGAACACTGTGGACACAGGAAGAACAGTCGTTTGCACCATTCATCAACCTAGCATTGATATCTTTGAAGCTTTTGATGAGTTGTTCTTGATGAAAAGAGGAGGACAAGAGCTATATGCTGGACCCATAGGTCGCAATTCCTGCGAGTTAATCGAGTACTTTGAGGCCATAAATGGCGTGAGTAAGATTACAGATGGATACAACCCCGCGACATGGATGTTAGAAGTCAGTACCTCAGTACAAGAAGCCGCTCTTGGAGTTGATTTCACTTCAATCTACAGAAATTCTGAACTTTACAAGAGAAACAAAGCCTTAATTGCCGAATTAAGTGTACCACGTCCTGGCACAAAAGATCTCTTCTTCCCGACTCAATACTCGCAGTCGTTCCTCGTACAATGCATAGCCTGTTTATGGAAACAACGTTGGTCATACTGGCGAAACCCGCCTTACACAGCCGTACGTTTTGTCTTCACTACATTCATCGGGGTCATTTTTGGTACTATGTTTTGGGATATCGGCGGTAAAAGAAACACCCCACAAAATTTGACTAACTCCATTGGTTCTATGTACGGTGCGGTTCTTTTCTTGNGAGTCCAAAACGCATCAGCAGTGCAACCAGTTGTTGATATTGAACGGACAGTCTTTTATAGAGAAAGAGCCGCT


Protein sequences

Name Description Sequence
Aan.94001 translated coding region predicted by ESTScan from UniGene Aan.94001

ELVANPAIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQELYAGPIGRNSCELIEYFEAINGVSKITDGYNPATWMLEVSTSVQEAALGVDFTSIYRNSELYKRNKALIAELSVPRPGTKDLFFPTQYSQSFLVQCIACLWKQRWSYWRNPPYTAVRFVFTTFIGVIFGTMFWDIGGKRNTPQNLTNSIGSMYGAVLFLXVQNASAVQPVVDIERTVFYRERAA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241
1-251 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

ELVANPAIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQELYAGPIGRNSCELIEYFEAINGVSKITDGYNPATWMLEVSTSVQEAALGVDFTSIYRNSELYKRNKALIAELSVPRPGTKDLFFPTQYSQSFLVQCIACLWKQRWSYWRNPPYTAVRFVFTTFIGVIFGTMFWDIGGKRNTPQNLTNSIGSMYGAVLFLXVQNASAVQPVVDIERTVFYRERAA

HMMPanther: PTHR19241:SF10
1-251 ATP-BINDING CASSETTE TRANSPORTER (PDR),ATP-BINDING CASSETTE TRANSPORTER (PDR)

ELVANPAIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGGQELYAGPIGRNSCELIEYFEAINGVSKITDGYNPATWMLEVSTSVQEAALGVDFTSIYRNSELYKRNKALIAELSVPRPGTKDLFFPTQYSQSFLVQCIACLWKQRWSYWRNPPYTAVRFVFTTFIGVIFGTMFWDIGGKRNTPQNLTNSIGSMYGAVLFLXVQNASAVQPVVDIERTVFYRERAA

superfamily: SSF52540
2-65 P-loop containing nucleoside triphosphate hydrolases

LVANPAIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRGG

Gene3D: G3DSA:3.40.50.300
2-64 no description

LVANPAIIFMDEPTSGLDARAAAIVMRTVRNTVDTGRTVVCTIHQPSIDIFEAFDELFLMKRG

HMMPfam: PF01061
IPR013525
162-251 ABC2_membrane
ABC-2 type transporter

QCIACLWKQRWSYWRNPPYTAVRFVFTTFIGVIFGTMFWDIGGKRNTPQNLTNSIGSMYGAVLFLXVQNASAVQPVVDIERTVFYRERAA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox