PRGDB00193938 (Cpo.1533)

From PRG Wiki
Jump to: navigation, search
Cpo.1533
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 303323294 (XM_003071593)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Coccidioides posadasii

Comment?

Coccidioides posadasii C735 delta SOWgp calcium

DNA Sequence

TCACCTCTCCGTCAGTGCTCACAGAAATCAATGCTATGGTTTGATCCCTGGTGATCCGCAAGGCAGAGGTCAACAGAACGCTTAGACCCCTTCTTTCCACAAGGTCACCTTGTCTTATTCAAGAACCACTTTCTGTTTTCTGTTTGCTTCCGTTCGATTGTGTTTTTCTGCCCCGCCCCAGCGCTCCCAAGCCGCCGTCGCACTACCCTTGAAAAGTTACGGCCACCAGTCTCTTCTCCCAGCGCTTGAGAGGATCGATCTTCAAACAGTAATAAATATGAGTTTCACAACTATGCTCAATAAGCTGCAAGGGCAACCTGAAAGCTACGAGAAAAAAGCACAGTACAAATTTGGTAGGACGCTAGGCGCTGGAACATATGGCATTGTTCGTGAAGCAGAAGGCCCGAATGGAAAGGCAGCCGTCAAGATAATTCTCAAGAAGAATGTGAAAGGCAACGAACAGATGGTCTACGATGAACTTGATATGTTGCAACGCCTTCACCATCCCCACATTGTCAGATTCCATGATTGGTTTGAATCGAGGGATAAATACTATATCGTAACCCAGTTAGCTACTGGCGGAGAGTTGTTCGATAGAATCTGTGACTATGGAAAATTCACGGAGAAGGATGCTTCCCAGACAATCCTGCAGGTGCTGGATGCTGTCAACTACCTGCATGAGCGCAATATCGTCCATCGAGATTTGAAGCCTGAGAACCTCCTTTATCTCACTCGCGCCCAAGATTCACAGCTCGTCTTGGCCGATTTTGGAATTGCAAAAATGTTGCACAGTCCATCTGAAGTCCTCACAAATATGGCGGGTTCATTCGGTTATGCTGCCCCCGAGGTGATGTTGAAGCAGGGACATGGAAAAGCCGTCGACATGTGGTCTCTCGGGGTTATCACTTATACATTACTCTGCGGTTATTCTCCATTCCGCTCTGAGAACCTCCAAGACTTGATCGACGAATGCCGAAGCGGCCATATCGTGTTCCATGAAAGATACTGGAGAGACGTTTCCAAAGATGCCAAGGACTTTATCCTCACGCTCCTACAGACTGACCCAACCAAACGAGCAACAAGTGCGGAAGCACTTCAGCACCGATGGCTGAAGGGAGAGACCGCTACTGACCACAACTTGTTGCCAGAACTCAAGGCATACATGGCCAAGGCTCGTCTCAAGCGGGGTATCGAGATCGTGAAGTTGGCCAACCGTATCGAAGCCCTCAAAATGCAGGGAGAAGACGATGACGATATTCCTAGCGCTATCCCAGACAATACGACCCCCTCTTCCAACAGCGGACCAGGAGACCAGACCTCTCCGGTGACTGCGCCCACCAACAAGAAGCGAAGCCTTAGCAGAGCTGCAAAGAGTGCTATTTTCCGTGAAGTGGTGCTCGCCAAAGTCCGCGAGATGAGGCAACAAGAGCAAAAGGAGAAAGTGGAGAAAGAGGCACTAGAAAGGGCAGAAAAGGAGAAACACAAATAGGGCACTCATTTTCCAAAAGCAATATGACTTGATACCCTTGTTGCCTCACATGTCCTTGTTGATGTTTGTTGTGTTCTAGTGGAAATTAGAATAAAAATGTGATCTCTGTCGAAATCTGGTCTAAGTCATGCTTCGCGGAAAACTCGGGTGTGCTTATTTCTCTAGGTATACATAGGAGTTCAAAGAGTGTTATGCGAAATCTGTCTCCCCTTTATAATCTATGCGCCTGTATATATGCCAGGGATCAGTCCGGGTGACAACGATTGCAATGTGACAGTCCGA


Protein sequences

Name Description Sequence
Cpo.1533 translated coding region predicted by ESTScan from UniGene Cpo.1533

XHLSVSAHRNQCYGLIPGDPQGRGQQNAXTPSFHKVTLSYSRTTFCFLFASVRLCFSAPPQRSQAAVALPLKSYGHQSLLPALERIDLQTVINMSFTTMLNKLQGQPESYEKKAQYKFGRTLGAGTYGIVREAEGPNGKAAVKIILKKNVKGNEQMVYDELDMLQRLHHPHIVRFHDWFESRDKYYIVTQLATGGELFDRICDYGKFTEKDASQTILQVLDAVNYLHERNIVHRDLKPENLLYLTRAQDSQLVLADFGIAKMLHSPSEVLTNMAGSFGYAAPEVMLKQGHGKAVDMWSLGVITYTLLCGYSPFRSENLQDLIDECRSGHIVFHERYWRDVSKDAKDFILTLLQTDPTKRATSAEALQHRWLKGETATDHNLLPELKAYMAKARLKRGIEIVKLANRIEALKMQGEDDDDIPSAIPDNTTPSSNSGPGDQTSPVTAPTNKKRSLSRAAKSAIFREVVLAKVREMRQQEQKEKVEKEALERAEKEKHK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24347
IPR020636
83-412 FAMILY NOT NAMED
Calcium/calmodulin-dependent/calcium-dependent pro

LERIDLQTVINMSFTTMLNKLQGQPESYEKKAQYKFGRTLGAGTYGIVREAEGPNGKAAVKIILKKNVKGNEQMVYDELDMLQRLHHPHIVRFHDWFESRDKYYIVTQLATGGELFDRICDYGKFTEKDASQTILQVLDAVNYLHERNIVHRDLKPENLLYLTRAQDSQLVLADFGIAKMLHSPSEVLTNMAGSFGYAAPEVMLKQGHGKAVDMWSLGVITYTLLCGYSPFRSENLQDLIDECRSGHIVFHERYWRDVSKDAKDFILTLLQTDPTKRATSAEALQHRWLKGETATDHNLLPELKAYMAKARLKRGIEIVKLANRIEALKM

HMMPanther: PTHR24347:SF29
IPR020651
83-412 SUBFAMILY NOT NAMED
Calcium/calmodulin-dependent protein kinase CMK, f

LERIDLQTVINMSFTTMLNKLQGQPESYEKKAQYKFGRTLGAGTYGIVREAEGPNGKAAVKIILKKNVKGNEQMVYDELDMLQRLHHPHIVRFHDWFESRDKYYIVTQLATGGELFDRICDYGKFTEKDASQTILQVLDAVNYLHERNIVHRDLKPENLLYLTRAQDSQLVLADFGIAKMLHSPSEVLTNMAGSFGYAAPEVMLKQGHGKAVDMWSLGVITYTLLCGYSPFRSENLQDLIDECRSGHIVFHERYWRDVSKDAKDFILTLLQTDPTKRATSAEALQHRWLKGETATDHNLLPELKAYMAKARLKRGIEIVKLANRIEALKM

superfamily: SSF56112
IPR011009
98-431 Protein kinase-like (PK-like)
Protein kinase-like domain

TMLNKLQGQPESYEKKAQYKFGRTLGAGTYGIVREAEGPNGKAAVKIILKKNVKGNEQMVYDELDMLQRLHHPHIVRFHDWFESRDKYYIVTQLATGGELFDRICDYGKFTEKDASQTILQVLDAVNYLHERNIVHRDLKPENLLYLTRAQDSQLVLADFGIAKMLHSPSEVLTNMAGSFGYAAPEVMLKQGHGKAVDMWSLGVITYTLLCGYSPFRSENLQDLIDECRSGHIVFHERYWRDVSKDAKDFILTLLQTDPTKRATSAEALQHRWLKGETATDHNLLPELKAYMAKARLKRGIEIVKLANRIEALKMQGEDDDDIPSAIPDNTTPS

Gene3D: G3DSA:3.30.200.20
109-208 no description

SYEKKAQYKFGRTLGAGTYGIVREAEGPNGKAAVKIILKKNVKGNEQMVYDELDMLQRLHHPHIVRFHDWFESRDKYYIVTQLATGGELFDRICDYGKFT

ProfileScan: PS50011
IPR000719
116-371 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YKFGRTLGAGTYGIVREAEGPNGKAAVKIILKKNVKGNEQMVYDELDMLQRLHHPHIVRFHDWFESRDKYYIVTQLATGGELFDRICDYGKFTEKDASQTILQVLDAVNYLHERNIVHRDLKPENLLYLTRAQDSQLVLADFGIAKMLHSPSEVLTNMAGSFGYAAPEVMLKQGHGKAVDMWSLGVITYTLLCGYSPFRSENLQDLIDECRSGHIVFHERYWRDVSKDAKDFILTLLQTDPTKRATSAEALQHRWL

HMMSmart: SM00219
IPR020635
116-371 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YKFGRTLGAGTYGIVREAEGPNGKAAVKIILKKNVKGNEQMVYDELDMLQRLHHPHIVRFHDWFESRDKYYIVTQLATGGELFDRICDYGKFTEKDASQTILQVLDAVNYLHERNIVHRDLKPENLLYLTRAQDSQLVLADFGIAKMLHSPSEVLTNMAGSFGYAAPEVMLKQGHGKAVDMWSLGVITYTLLCGYSPFRSENLQDLIDECRSGHIVFHERYWRDVSKDAKDFILTLLQTDPTKRATSAEALQHRWL

HMMSmart: SM00220
IPR002290
116-371 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YKFGRTLGAGTYGIVREAEGPNGKAAVKIILKKNVKGNEQMVYDELDMLQRLHHPHIVRFHDWFESRDKYYIVTQLATGGELFDRICDYGKFTEKDASQTILQVLDAVNYLHERNIVHRDLKPENLLYLTRAQDSQLVLADFGIAKMLHSPSEVLTNMAGSFGYAAPEVMLKQGHGKAVDMWSLGVITYTLLCGYSPFRSENLQDLIDECRSGHIVFHERYWRDVSKDAKDFILTLLQTDPTKRATSAEALQHRWL

HMMPfam: PF00069
IPR000719
116-371 Pkinase,Ser-thr
Protein kinase, catalytic domain

YKFGRTLGAGTYGIVREAEGPNGKAAVKIILKKNVKGNEQMVYDELDMLQRLHHPHIVRFHDWFESRDKYYIVTQLATGGELFDRICDYGKFTEKDASQTILQVLDAVNYLHERNIVHRDLKPENLLYLTRAQDSQLVLADFGIAKMLHSPSEVLTNMAGSFGYAAPEVMLKQGHGKAVDMWSLGVITYTLLCGYSPFRSENLQDLIDECRSGHIVFHERYWRDVSKDAKDFILTLLQTDPTKRATSAEALQHRWL

PatternScan: PS00107
IPR017441
122-147 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGAGTYGIVREAEGPNGKAAVKIILK

PatternScan: PS00108
IPR008271
231-243 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKPENLLY

Gene3D: G3DSA:1.10.510.10
412-433 no description

MQGEDDDDIPSAIPDNTTPSSN

Coil: coil
467-494 coiled-coil

LAKVREMRQQEQKEKVEKEALERAEKEK

Seg: seg
469-496 seg

KVREMRQQEQKEKVEKEALERAEKEKHK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox