PRGDB00193942 (Cpo.1988)

From PRG Wiki
Jump to: navigation, search
Cpo.1988
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 303318598 (XM_003069253)
Gene Class Unknown
Domain Type
Gene Species Coccidioides posadasii

Comment?

Coccidioides posadasii C735 delta SOWgp Flavin-binding monooxygenase-like family protein, mRNA

DNA Sequence

GGGAATTTAGATGCCCTCTCTTTCAAAATGAACTGGTATCGCCATTCAAAAGTGTTTGAACTGTCAGTCTCAAACATGTTGGCCTCAGAGTGTAGATTCAACAAATCCTAGGAGCTTTTTCGTTGGCTTGTGGTGATCTATACACACACCCTCCTCAAGCCTGAACATCAAAGCATCTTTTTCCATTTGATTGATTTATAGTGATGCGTTGCTGGAGGACGCAAGCTTGCGTGTTATCAGAGGATGGAATGCATGCAGCTCAAGCACAGACTGGTAACTCTAACTACCCTGATGTTGGGAAAGAGCCCCTTTCCAACCGCCAACTCATCCACCCGTAGTTCAGCAACGCGAGCCATGTACTTTCACAGAGATCTATTTAGGTATCCTTATGCTTGCCGGCAATTTCCCGGACGCGCCGAAAGACCCGTGTTGTATCACATGGGAACGATAAGACTGTGATACTATTGTGTCTATTGTGCCTGTGACGATCTGACTTCGCGTCCCTCTCACCGTCTCTTTCCTTACGAACCAGCATCGAATAAATGGCTCCAAAGGTTGCAATCATCGGGGCCGGTCTCTCAGGACTTGCGTCCCTGAAACAGTGTCTCGAGGAGGGCTTCGATGCCACAATCTTCGAGGCTCGTCCTGTCATCGGAGGCCAGTGGTGCTATGAGGAGCCAGATCCAGTTACCGGCGAAACATCCTCTTCGATGTACGAAGGAGTCTTGTTGAATTCTTGTCGTGACACCTCGACTTTTAGCGACTTTCCTATGGACCCTAGCCGCTATCCCGACTACTTTGGTCACAAGCGCTTTTTGCGATACATCGAAGAGTATGCGGAGTATTTCGGACTCAGAGAGCATATCTGTTTGAACACCGAAGTCGTTTCCTGCTCACAAGACAAGGAAGGGAAATGGAGTGTCAAGACAATCCAGAAAGGAAGATCCCCTGTCAAAGATACTTACGATGCGATCTTCGCGTGTTCAGGTGCGCTTGCAGACCCAGTTATTCCCATGTTTGAGGGACTGGAGAAATTCAAAGGTGACGTTTTCCACAGTCATATTTATAGGCGCCCAGGCGCACTTGAAGGAAGAAGAATCGCCATCATCGGTTTCGGTAATTCCGCCGCAGATTTATCTTCTGAGTTGAGCTGGCAGGCGAAAGAGCTGCATCTTATTACTCGCAGAGGCGGATGGATCGTCCCTCGCTTCGTTTTGGGCAAACCGGCAGAGGCATATGACAATCGTGTCGCAGAAACAATCTTGCCATCCAAGTTTTCCCAGTGGATCCAAACGCAGCTCTGCAACCACGTTCTGGGCAAGCTCCCGGATGTCCTGCAGCCAGAGCATGGGCTCATGGAAGCAAATGTCACAATGCGAAGTGACCTGCTTGAAAACATCAAAACCGGTCGTATCATCCCTCACAGAGCTGGAGTGAAAAGAGTCTCAGAGACATCTTTGATTTTAACTGACGGTACATTCATTGATGTCGATGTTATCATCTGCTGCACTGGATATCACATGAGCATTCCGTACGTACCCGAGGAGAGTTACCGAAATAACCATAATCCAATCCTTAACACCAACAATTCGATGGAACTCTATAAATTAGTCGCATCTCCAACCTTCCCGAACGTGTTTTTCATCGGCTTCGTTGAGCTCGCAGGCCCTCTGGTCCCGGTCTCAGAGACACAGGCAAGATGGGCGACTTCGGTACTTGCCGGTAGGATCAAGCTGCCTTCCGTCAAGATGATGTATGGATCGATAGCCGCGTACCAAGCGCGCCTAGCTGCCGTGATGGTGAATTCCGATCGACACACTGTCACCATTCGCTACCTACCTTACTGCGATGATCTCCTGAGGGATATCGGCGCTAATCCGACATTCTGTCGCCTGTTTTCTAAGGTCTTCACCTCCAATCCTGTCACAGCAGTCAAGGTGCTCAAGGCAGTGTACCTTGGAATAAATTCTCCGGCACAATATCGTCTATTTGGCCACGGAAGTAAGCCCATGCTTGCATCCGCCACATTGTTAAGACTCGCCGACGAAGCTCCGGGACTGAGCGAAAAGGAGAGACATATTCTTTGCATGAGCCAGCCTGAAGGATAATAAAAAACGGAAGCCCATTTGTTTACCTGGCGAAAAATCGAGATACCTATCTTTATGATATCCCCTAGTGATGTACCTAAGAGAAACATTCCATGATCCGCGCACCCGACTAATCAGCCCATGTTGACCTCACAACTGTGGCCTGATTGCGGAAAAAAGCGAGGGTCAGATATCCTGTTCTTAGCCAAACTCGTGATCAGAAAAAACGCTCCCGGGATACTCTGTTATTTCACGCAGGATATGACCTGCATTTGTAAGCTGCAAGCCGTCAAAACTTCATCCCGGCTATCTGCTCAGAGATTAGCTGCTTTTTCAGCTTTTCGTGCTTCAGAACCAACAATCCCAGAGTTCCCCAT


Protein sequences

Name Description Sequence
Cpo.1988 translated coding region predicted by ESTScan from UniGene Cpo.1988

MAPKVAIIGAGLSGLASLKQCLEEGFDATIFEARPVIGGQWCYEEPDPVTGETSSSMYEGVLLNSCRDTSTFSDFPMDPSRYPDYFGHKRFLRYIEEYAEYFGLREHICLNTEVVSCSQDKEGKWSVKTIQKGRSPVKDTYDAIFACSGALADPVIPMFEGLEKFKGDVFHSHIYRRPGALEGRRIAIIGFGNSAADLSSELSWQAKELHLITRRGGWIVPRFVLGKPAEAYDNRVAETILPSKFSQWIQTQLCNHVLGKLPDVLQPEHGLMEANVTMRSDLLENIKTGRIIPHRAGVKRVSETSLILTDGTFIDVDVIICCTGYHMSIPYVPEESYRNNHNPILNTNNSMELYKLVASPTFPNVFFIGFVELAGPLVPVSETQARWATSVLAGRIKLPSVKMMYGSIAAYQARLAAVMVNSDRHTVTIRYLPYCDDLLRDIGANPTFCRLFSKVFTSNPVTAVKVLKAVYLGINSPAQYRLFGHGSKPMLASATLLRLADEAPGLSEKERHILCMSQPEGXXKTEAHLFTWRKIEIPIFMISPSDVPKRNIPXSAHPTNQPMLTSQLWPDCGKKRGSDILFLAKLVIRKNAPGILCYFTQDMTCICKLQAVKTSSRLSAQRLAAFSAFRASEPTIPEFPX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23023
1-484 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

MAPKVAIIGAGLSGLASLKQCLEEGFDATIFEARPVIGGQWCYEEPDPVTGETSSSMYEGVLLNSCRDTSTFSDFPMDPSRYPDYFGHKRFLRYIEEYAEYFGLREHICLNTEVVSCSQDKEGKWSVKTIQKGRSPVKDTYDAIFACSGALADPVIPMFEGLEKFKGDVFHSHIYRRPGALEGRRIAIIGFGNSAADLSSELSWQAKELHLITRRGGWIVPRFVLGKPAEAYDNRVAETILPSKFSQWIQTQLCNHVLGKLPDVLQPEHGLMEANVTMRSDLLENIKTGRIIPHRAGVKRVSETSLILTDGTFIDVDVIICCTGYHMSIPYVPEESYRNNHNPILNTNNSMELYKLVASPTFPNVFFIGFVELAGPLVPVSETQARWATSVLAGRIKLPSVKMMYGSIAAYQARLAAVMVNSDRHTVTIRYLPYCDDLLRDIGANPTFCRLFSKVFTSNPVTAVKVLKAVYLGINSPAQYRLFG

superfamily: SSF51905
1-294 FAD/NAD(P)-binding domain

MAPKVAIIGAGLSGLASLKQCLEEGFDATIFEARPVIGGQWCYEEPDPVTGETSSSMYEGVLLNSCRDTSTFSDFPMDPSRYPDYFGHKRFLRYIEEYAEYFGLREHICLNTEVVSCSQDKEGKWSVKTIQKGRSPVKDTYDAIFACSGALADPVIPMFEGLEKFKGDVFHSHIYRRPGALEGRRIAIIGFGNSAADLSSELSWQAKELHLITRRGGWIVPRFVLGKPAEAYDNRVAETILPSKFSQWIQTQLCNHVLGKLPDVLQPEHGLMEANVTMRSDLLENIKTGRIIPH

FPrintScan: PR00370
IPR000960
3-19 FMOXYGENASE
Flavin monooxygenase FMO

PKVAIIGAGLSGLASLK

Gene3D: G3DSA:3.50.50.60
3-215 no description

PKVAIIGAGLSGLASLKQCLEEGFDATIFEARPVIGGQWCYEEPDPVTGETSSSMYEGVLLNSCRDTSTFSDFPMDPSRYPDYFGHKRFLRYIEEYAEYFGLREHICLNTEVVSCSQDKEGKWSVKTIQKGRSPVKDTYDAIFACSGALADPVIPMFEGLEKFKGDVFHSHIYRRPGALEGRRIAIIGFGNSAADLSSELSWQAKELHLITRR

HMMPfam: PF00743
IPR020946
4-488 FMO-like
Flavin monooxygenase-like

KVAIIGAGLSGLASLKQCLEEGFDATIFEARPVIGGQWCYEEPDPVTGETSSSMYEGVLLNSCRDTSTFSDFPMDPSRYPDYFGHKRFLRYIEEYAEYFGLREHICLNTEVVSCSQDKEGKWSVKTIQKGRSPVKDTYDAIFACSGALADPVIPMFEGLEKFKGDVFHSHIYRRPGALEGRRIAIIGFGNSAADLSSELSWQAKELHLITRRGGWIVPRFVLGKPAEAYDNRVAETILPSKFSQWIQTQLCNHVLGKLPDVLQPEHGLMEANVTMRSDLLENIKTGRIIPHRAGVKRVSETSLILTDGTFIDVDVIICCTGYHMSIPYVPEESYRNNHNPILNTNNSMELYKLVASPTFPNVFFIGFVELAGPLVPVSETQARWATSVLAGRIKLPSVKMMYGSIAAYQARLAAVMVNSDRHTVTIRYLPYCDDLLRDIGANPTFCRLFSKVFTSNPVTAVKVLKAVYLGINSPAQYRLFGHGSK

FPrintScan: PR00370
IPR000960
58-76 FMOXYGENASE
Flavin monooxygenase FMO

YEGVLLNSCRDTSTFSDFP

FPrintScan: PR00370
IPR000960
141-157 FMOXYGENASE
Flavin monooxygenase FMO

YDAIFACSGALADPVIP

FPrintScan: PR00370
IPR000960
197-212 FMOXYGENASE
Flavin monooxygenase FMO

DLSSELSWQAKELHLI

Gene3D: G3DSA:3.50.50.60
305-485 no description

SLILTDGTFIDVDVIICCTGYHMSIPYVPEESYRNNHNPILNTNNSMELYKLVASPTFPNVFFIGFVELAGPLVPVSETQARWATSVLAGRIKLPSVKMMYGSIAAYQARLAAVMVNSDRHTVTIRYLPYCDDLLRDIGANPTFCRLFSKVFTSNPVTAVKVLKAVYLGINSPAQYRLFGH

superfamily: SSF51905
306-495 FAD/NAD(P)-binding domain

LILTDGTFIDVDVIICCTGYHMSIPYVPEESYRNNHNPILNTNNSMELYKLVASPTFPNVFFIGFVELAGPLVPVSETQARWATSVLAGRIKLPSVKMMYGSIAAYQARLAAVMVNSDRHTVTIRYLPYCDDLLRDIGANPTFCRLFSKVFTSNPVTAVKVLKAVYLGINSPAQYRLFGHGSKPMLASAT

FPrintScan: PR00370
IPR000960
309-336 FMOXYGENASE
Flavin monooxygenase FMO

TDGTFIDVDVIICCTGYHMSIPYVPEES

FPrintScan: PR00370
IPR000960
362-379 FMOXYGENASE
Flavin monooxygenase FMO

FPNVFFIGFVELAGPLVP

FPrintScan: PR00370
IPR000960
379-392 FMOXYGENASE
Flavin monooxygenase FMO

PVSETQARWATSVL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox