PRGDB00193964 (Fpr.738)

From PRG Wiki
Jump to: navigation, search
Fpr.738
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237614032 (GO889643)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Festuca pratensis

Comment?

RDD_cLiFpEfI12nb_18x1_1_M17_cLibkit5_G09 RDD_cLiFpEfI12nb_plant Festuca pratensis cDNA clone 18M17 5', mRNA sequence

DNA Sequence

ACTAGAGTATCTTCATGAGCACTGCAATCCTCCAGTGATCCATAGGGATCTCAAATCATCTAATATACTTTTAGATTCAGACTTCAATGCTAAGATTGCAGATTTTGGACTTGCAGTTACCGGTGGGAATCTCGACAAAGGGAACCTGAAGATTTCTGGGACCTTGGGATATGTAGCTCCTGAATATTTATTAGATGGGAAGTTGACTGAGAAGAGTGATGTATACGCATTTGGGGTAGTGCTTTTAGAGCTCCTGATGGGAAGGAAGCCTGTTGAGAAGATGTCACCGTCTCAGTGCCAATCAATTGTGTCATGGGCCATGCCTCAGCTAACCGACAGATCGAAGCTCCCCAACATAATTGACCCAGTGATCAAGGACACAATGGACCCAAAACACTTGTACCAAGTTGCGGCAGTAGCTGTTCTTTGTGTGCAGCCCGAACCGAGTTACAGACCGCTGATAACAGATGTTCTCCACTCTCTTGTTCCTCTAGTGCCCTCGGAGCTCGGGGGAACACTTAGGGTTACAGAGCCACCTCCTCCAAGCCAAATGCATTGTCCTTCTTGAGATGTCATCCTACAAGTTTCGTCGAAGCAGGGTGAATTATACTGTCCAATGTAGATTAGTGTTTATTGTGTAACTTATCTTGCCTGTACCTGCTGCTTGTCTGAGGATGGGATTTCCATCCTACTGATTTTGCTGGGTGGACAGAGAGAATTCTGCTTTGGAGAGAATTGTCTCATATATCTTTTCATTGTACAAAGAAGTGAAGAAAGGAATTTTCTTTTCTTTGGATCTGGCACTATGCTGTACAGATCTGAATTTTCCAGAC


Protein sequences

Name Description Sequence
Fpr.738 translated coding region predicted by ESTScan from UniGene Fpr.738

XLEYLHEHCNPPVIHRDLKSSNILLDSDFNAKIADFGLAVTGGNLDKGNLKISGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVSWAMPQLTDRSKLPNIIDPVIKDTMDPKHLYQVAAVAVLCVQPEPSYRPLITDVLHSLVPLVPSELGGTLRVTEPPPPSQMHCPS

Domains

Domain Start-End Description Sequence

HMMSmart: SM00219
IPR020635
1-162 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XLEYLHEHCNPPVIHRDLKSSNILLDSDFNAKIADFGLAVTGGNLDKGNLKISGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVSWAMPQLTDRSKLPNIIDPVIKDTMDPKHLYQVAAVAVLCVQPEPSYRPLITDVLHSL

ProfileScan: PS50011
IPR000719
1-163 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XLEYLHEHCNPPVIHRDLKSSNILLDSDFNAKIADFGLAVTGGNLDKGNLKISGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVSWAMPQLTDRSKLPNIIDPVIKDTMDPKHLYQVAAVAVLCVQPEPSYRPLITDVLHSLV

HMMPfam: PF00069
IPR000719
2-160 Pkinase,Ser-thr
Protein kinase, catalytic domain

LEYLHEHCNPPVIHRDLKSSNILLDSDFNAKIADFGLAVTGGNLDKGNLKISGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVSWAMPQLTDRSKLPNIIDPVIKDTMDPKHLYQVAAVAVLCVQPEPSYRPLITDVLH

HMMPanther: PTHR24420:SF449
2-170 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LEYLHEHCNPPVIHRDLKSSNILLDSDFNAKIADFGLAVTGGNLDKGNLKISGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVSWAMPQLTDRSKLPNIIDPVIKDTMDPKHLYQVAAVAVLCVQPEPSYRPLITDVLHSLVPLVPSEL

HMMPanther: PTHR24420
2-170 FAMILY NOT NAMED,FAMILY NOT NAMED

LEYLHEHCNPPVIHRDLKSSNILLDSDFNAKIADFGLAVTGGNLDKGNLKISGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVSWAMPQLTDRSKLPNIIDPVIKDTMDPKHLYQVAAVAVLCVQPEPSYRPLITDVLHSLVPLVPSEL

superfamily: SSF56112
IPR011009
2-162 Protein kinase-like (PK-like)
Protein kinase-like domain

LEYLHEHCNPPVIHRDLKSSNILLDSDFNAKIADFGLAVTGGNLDKGNLKISGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVSWAMPQLTDRSKLPNIIDPVIKDTMDPKHLYQVAAVAVLCVQPEPSYRPLITDVLHSL

Gene3D: G3DSA:1.10.510.10
2-162 no description

LEYLHEHCNPPVIHRDLKSSNILLDSDFNAKIADFGLAVTGGNLDKGNLKISGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVSWAMPQLTDRSKLPNIIDPVIKDTMDPKHLYQVAAVAVLCVQPEPSYRPLITDVLHSL

HMMSmart: SM00220
IPR002290
2-163 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LEYLHEHCNPPVIHRDLKSSNILLDSDFNAKIADFGLAVTGGNLDKGNLKISGTLGYVAPEYLLDGKLTEKSDVYAFGVVLLELLMGRKPVEKMSPSQCQSIVSWAMPQLTDRSKLPNIIDPVIKDTMDPKHLYQVAAVAVLCVQPEPSYRPLITDVLHSLV

PatternScan: PS00108
IPR008271
13-25 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox