PRGDB00193965 (Fpr.1377)

From PRG Wiki
Jump to: navigation, search
Fpr.1377
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237572759 (GO842584)
Gene Class Unknown
Domain Type
Gene Species Festuca pratensis

Comment?

CLS_CLiFpEfSpn_115a1_1_o21cLibkit5LD_H11 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 115o21 5', mRNA sequence

DNA Sequence

ACTTCGAGTTTGAGAGAATGGCTTCCAAGGGCAAGGTGTGTGTTACTGGGGCCTCTGGCTTTGTTGCTTCTTGGCTTGTCAAAAGACTTCTCGAGTCCGGTTATAATGTTCTAGGGACAGTCAGAGACCCAGGCAATCAGAAGAAGGTAGCACACCTCTGGAACTTAGCAGGGGCCAAGGAAAGGCTGGAGCTTGTGAGAGCTGACCTCTTGGAAGAAGGGAGCTTCGATGATGCCGTGATGGCCTGTGAGGGTGTCTTCCACACTGCATCACCTATCATCACCGAATCTGATACCAAGGAAGAAATGCTTGATTCTGCAATAAACGGCACTCTAAACGTGCTGAGGTCGTGCAAGAAGAATCCTTTTCTCAAAAGGGTTGTTCTCACGTCATCATCGTCAACCGTGAGGCTGAGGGATGAGGCTGAATTCCCACCCAACGTGTTGCTGGATGAAACATCATGGAGCTCCGTGGAGTTCTGTGAAAGTATCCAGGTATGGTACGGTGTCGCAAAGATCCTTGCCGAGAAATCAGCTTGGGAGTTTGCCAAGGAGAACAACATCGACCTAGTGGCTGTTCTTCCAACATTCGTGATTGGACGTAATCTCTCATCTGAATTAGGACCCACTGTTTTAGATGTCCTTGGCTTATTTAAAGGAGAGACAGAGAAGTTCACCATGTTTGGAAGGATGGGGTACGTCCACATCGACGACATAGCCAGCTGCCACATCCTGGTCTATGAAACCACCAATGCTAAAGGGAGGTACATATGCAACTCGGCGGTTCTGAATAGCAACGACCTCGTTGCTTTCCTCGCGAAACGATTCCCATCGTTCCCCATCCCGAAGAGTTTACCGAACATTTACAGGGAGCAGACGTATGGTTACAACACGTCCAAGATTCGGAAGCTGGGCCTCGAGTTCAAGGGGTGGAGGAGATGTTTGATGACGCGGTGGAGTCGCTCAAAGGTCATGGCTATCTGCTGGAGAGTGCGGATGATGCGGATGAAAGGACCAATCCCTTCGCGGAGAGATGCAATTTAGTACATGAGAAAATGAT


Protein sequences

Name Description Sequence
Fpr.1377 translated coding region predicted by ESTScan from UniGene Fpr.1377

XFEFERMASKGKVCVTGASGFVASWLVKRLLESGYNVLGTVRDPGNQKKVAHLWNLAGAKERLELVRADLLEEGSFDDAVMACEGVFHTASPIITESDTKEEMLDSAINGTLNVLRSCKKNPFLKRVVLTSSSSTVRLRDEAEFPPNVLLDETSWSSVEFCESIQVWYGVAKILAEKSAWEFAKENNIDLVAVLPTFVIGRNLSSELGPTVLDVLGLFKGETEKFTMFGRMGYVHIDDIASCHILVYETTNAKGRYICNSAVLNSNDLVAFLAKRFPSFPIPKSLPNIYREQTYGYNTSKIRKLGLEFKXVEEMFDDAVESLKGHGYLLESADDADERTNPFAERCNLVHEKMX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366
1-348 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

XFEFERMASKGKVCVTGASGFVASWLVKRLLESGYNVLGTVRDPGNQKKVAHLWNLAGAKERLELVRADLLEEGSFDDAVMACEGVFHTASPIITESDTKEEMLDSAINGTLNVLRSCKKNPFLKRVVLTSSSSTVRLRDEAEFPPNVLLDETSWSSVEFCESIQVWYGVAKILAEKSAWEFAKENNIDLVAVLPTFVIGRNLSSELGPTVLDVLGLFKGETEKFTMFGRMGYVHIDDIASCHILVYETTNAKGRYICNSAVLNSNDLVAFLAKRFPSFPIPKSLPNIYREQTYGYNTSKIRKLGLEFKXVEEMFDDAVESLKGHGYLLESADDADERTNPFAERCNL

HMMPanther: PTHR10366:SF9
1-348 CINNAMOYL-COA REDUCTASE,CINNAMOYL-COA REDUCTASE

XFEFERMASKGKVCVTGASGFVASWLVKRLLESGYNVLGTVRDPGNQKKVAHLWNLAGAKERLELVRADLLEEGSFDDAVMACEGVFHTASPIITESDTKEEMLDSAINGTLNVLRSCKKNPFLKRVVLTSSSSTVRLRDEAEFPPNVLLDETSWSSVEFCESIQVWYGVAKILAEKSAWEFAKENNIDLVAVLPTFVIGRNLSSELGPTVLDVLGLFKGETEKFTMFGRMGYVHIDDIASCHILVYETTNAKGRYICNSAVLNSNDLVAFLAKRFPSFPIPKSLPNIYREQTYGYNTSKIRKLGLEFKXVEEMFDDAVESLKGHGYLLESADDADERTNPFAERCNL

superfamily: SSF51735
11-324 NAD(P)-binding Rossmann-fold domains

GKVCVTGASGFVASWLVKRLLESGYNVLGTVRDPGNQKKVAHLWNLAGAKERLELVRADLLEEGSFDDAVMACEGVFHTASPIITESDTKEEMLDSAINGTLNVLRSCKKNPFLKRVVLTSSSSTVRLRDEAEFPPNVLLDETSWSSVEFCESIQVWYGVAKILAEKSAWEFAKENNIDLVAVLPTFVIGRNLSSELGPTVLDVLGLFKGETEKFTMFGRMGYVHIDDIASCHILVYETTNAKGRYICNSAVLNSNDLVAFLAKRFPSFPIPKSLPNIYREQTYGYNTSKIRKLGLEFKXVEEMFDDAVESLKG

Gene3D: G3DSA:3.40.50.720
IPR016040
12-224 no description
NAD(P)-binding domain

KVCVTGASGFVASWLVKRLLESGYNVLGTVRDPGNQKKVAHLWNLAGAKERLELVRADLLEEGSFDDAVMACEGVFHTASPIITESDTKEEMLDSAINGTLNVLRSCKKNPFLKRVVLTSSSSTVRLRDEAEFPPNVLLDETSWSSVEFCESIQVWYGVAKILAEKSAWEFAKENNIDLVAVLPTFVIGRNLSSELGPTVLDVLGLFKGETEK

HMMPfam: PF01370
IPR001509
13-255 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGASGFVASWLVKRLLESGYNVLGTVRDPGNQKKVAHLWNLAGAKERLELVRADLLEEGSFDDAVMACEGVFHTASPIITESDTKEEMLDSAINGTLNVLRSCKKNPFLKRVVLTSSSSTVRLRDEAEFPPNVLLDETSWSSVEFCESIQVWYGVAKILAEKSAWEFAKENNIDLVAVLPTFVIGRNLSSELGPTVLDVLGLFKGETEKFTMFGRMGYVHIDDIASCHILVYETTNAKGR

Seg: seg
126-139 seg

RVVLTSSSSTVRLR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox