PRGDB00193966 (Fpr.1583)

From PRG Wiki
Jump to: navigation, search
Fpr.1583
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237623154 (GO894216)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Festuca pratensis

Comment?

RDD_cLiFpEfI12nb_2x1_4_J24_cLibkitLD5_E12 RDD_cLiFpEfI12nb_plant Festuca pratensis cDNA clone 2J24 5', mRNA sequence

DNA Sequence

CGGGGGGTTTGGATATGTTCATTCGCAAGGAGTAATCCACCGTGATGTGAAACCTGAGAACATTCTATTTGATGGAGAATGTTGTGCAAAGGTCGTTGATTTTGGAGTAGCTTTTGAAGATGTATACTGCAATACACTGGAAGATGACCCAGGTACATATAGATGGATGGCGCCGGAAATGTGTAAGCGGAAGCCGTATTGTCGGAAAGTTGATGTTTATAGTTTTGGCCTTGTCTTGTGGGAATTGGTTAGTGGTTCAATGCCTTATGAAGGGATGACTCCACTCCAGGCAGCTTTCGCTGTTGTTAATAAGAACTTGAGACCAGTTGTTCCTTCGAACTGCCCAACACCAGTACAACAATTGATGGAGCAATGCTGGTCCGTTCAACCAGACAAGAGGCCTGAGTTTAACCAAATAGTTAAAACGCTTGAAAATCTCAAGAAGGTTCTTGATAGAGATGGAACACTTGACAAGATCCTAGACGCCAGCTGCCAGGAAGCTCAGGACCAAAACAAGAACAGGCTTGCGAACTGGATCCAAAAGCTCTCATATAGCCAGCCTGATTTCTCAGGGACTCCACCGCCAAAGCTACTGTAATTATGTGTCCTTCCCTTCTCCCCCGAAATGTGTTCCGTGATAGATCACAACTCTGAAAAATCAATTTTTCTATGTATATAAACACAAAACTACTGAAGAGGCATTTTATTTACAGAACACCATAAATACTTGTCCGCAAAAAAAAAAAAAAA


Protein sequences

Name Description Sequence
Fpr.1583 translated coding region predicted by ESTScan from UniGene Fpr.1583

XGGFGYVHSQGVIHRDVKPENILFDGECCAKVVDFGVAFEDVYCNTLEDDPGTYRWMAPEMCKRKPYCRKVDVYSFGLVLWELVSGSMPYEGMTPLQAAFAVVNKNLRPVVPSNCPTPVQQLMEQCWSVQPDKRPEFNQIVKTLENLKKVLDRDGTLDKILDASCQEAQDQNKNRLANWIQKLSYSQPDFSGTPPPKLL

Domains

Domain Start-End Description Sequence

HMMSmart: SM00220
IPR002290
1-151 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XGGFGYVHSQGVIHRDVKPENILFDGECCAKVVDFGVAFEDVYCNTLEDDPGTYRWMAPEMCKRKPYCRKVDVYSFGLVLWELVSGSMPYEGMTPLQAAFAVVNKNLRPVVPSNCPTPVQQLMEQCWSVQPDKRPEFNQIVKTLENLKKVL

ProfileScan: PS50011
IPR000719
1-147 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XGGFGYVHSQGVIHRDVKPENILFDGECCAKVVDFGVAFEDVYCNTLEDDPGTYRWMAPEMCKRKPYCRKVDVYSFGLVLWELVSGSMPYEGMTPLQAAFAVVNKNLRPVVPSNCPTPVQQLMEQCWSVQPDKRPEFNQIVKTLENL

HMMSmart: SM00219
IPR020635
2-144 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

GGFGYVHSQGVIHRDVKPENILFDGECCAKVVDFGVAFEDVYCNTLEDDPGTYRWMAPEMCKRKPYCRKVDVYSFGLVLWELVSGSMPYEGMTPLQAAFAVVNKNLRPVVPSNCPTPVQQLMEQCWSVQPDKRPEFNQIVKTL

HMMPanther: PTHR23257:SF81
3-199 PROTEIN-TYROSINE KINASE,PROTEIN-TYROSINE KINASE

GFGYVHSQGVIHRDVKPENILFDGECCAKVVDFGVAFEDVYCNTLEDDPGTYRWMAPEMCKRKPYCRKVDVYSFGLVLWELVSGSMPYEGMTPLQAAFAVVNKNLRPVVPSNCPTPVQQLMEQCWSVQPDKRPEFNQIVKTLENLKKVLDRDGTLDKILDASCQEAQDQNKNRLANWIQKLSYSQPDFSGTPPPKLL

superfamily: SSF56112
IPR011009
3-144 Protein kinase-like (PK-like)
Protein kinase-like domain

GFGYVHSQGVIHRDVKPENILFDGECCAKVVDFGVAFEDVYCNTLEDDPGTYRWMAPEMCKRKPYCRKVDVYSFGLVLWELVSGSMPYEGMTPLQAAFAVVNKNLRPVVPSNCPTPVQQLMEQCWSVQPDKRPEFNQIVKTL

HMMPanther: PTHR23257
3-199 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

GFGYVHSQGVIHRDVKPENILFDGECCAKVVDFGVAFEDVYCNTLEDDPGTYRWMAPEMCKRKPYCRKVDVYSFGLVLWELVSGSMPYEGMTPLQAAFAVVNKNLRPVVPSNCPTPVQQLMEQCWSVQPDKRPEFNQIVKTLENLKKVLDRDGTLDKILDASCQEAQDQNKNRLANWIQKLSYSQPDFSGTPPPKLL

HMMPfam: PF07714
IPR001245
3-144 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

GFGYVHSQGVIHRDVKPENILFDGECCAKVVDFGVAFEDVYCNTLEDDPGTYRWMAPEMCKRKPYCRKVDVYSFGLVLWELVSGSMPYEGMTPLQAAFAVVNKNLRPVVPSNCPTPVQQLMEQCWSVQPDKRPEFNQIVKTL

Gene3D: G3DSA:1.10.510.10
5-174 no description

GYVHSQGVIHRDVKPENILFDGECCAKVVDFGVAFEDVYCNTLEDDPGTYRWMAPEMCKRKPYCRKVDVYSFGLVLWELVSGSMPYEGMTPLQAAFAVVNKNLRPVVPSNCPTPVQQLMEQCWSVQPDKRPEFNQIVKTLENLKKVLDRDGTLDKILDASCQEAQDQNKN

FPrintScan: PR00109
IPR001245
6-24 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

YVHSQGVIHRDVKPENILF

PatternScan: PS00108
IPR008271
12-24 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKPENILF

FPrintScan: PR00109
IPR001245
52-62 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

GTYRWMAPEMC

FPrintScan: PR00109
IPR001245
71-93 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

VDVYSFGLVLWELVSGSMPYEGM

FPrintScan: PR00109
IPR001245
115-137 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

CPTPVQQLMEQCWSVQPDKRPEF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox