PRGDB00193967 (Fpr.2643)

From PRG Wiki
Jump to: navigation, search
Fpr.2643
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237590653 (GO865636)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Festuca pratensis

Comment?

CLS_CLiFpEfSpn_51a1_1_o01cLibkit5LD_H01 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 51o01 5', mRNA sequence

DNA Sequence

AGGTTGCTGTTTGGCATAAGCTCAGCCATCCTAATGTTACAAGGTTTGTTGGTGCATCTATGGGGACGACCGACCTTAAGGTTCCAGCCAACGACCATGGTGCGCGCGCCAACTTGCCGGCCAGAGCGTGTTGTGTTGTGGTAGAATATCTAGCTGGAGGCACTTTGAATCAATATTTGATAAACAACAGACGGCGGACCCTTGCATACTAAGTTGTGGTTCAGCTTGCATTGGATCTGACCCGAGGATTGAGCTATCTACACTCCAGAAAGATTGTACACCGTGATGTAAAAACTGAAAACATGTTACTTGATACCCACAGAAACCTTAAGATTGCGAATTTTGGCGTTGCTCGTGTTGAGGCTCAAAATCCGAAGGATATGACTGGTGCGACAGGCACACTTGGTTATATGGCCCCAGAGGTTCTTGATGGTAAACCATACAACAGGAAATGTGACGTTTACAGTTTTGGCATATGTCTGTGGGAAATCTATTGCTGTGACATGCCATACCCAAACCTAACTTTTGCTGATGTCTCTTCGGCTGTTGTTCATCAAAATTTGCGCCCAGACGTACCTCGTTGCTGCCCAAATCCATTTGCGAATATCATGCGTAAATGCTGGGACGGGAATCCTGATAAGCGTCCTAATATGGACGAGGTGGTGCAGCTTATGGAGGCTCTCGATACAAGCAAAGGTGGCGGTATGATACCAGATGGCCAGTCATCTGGATGCTTATGTTTCACCAGGGCACGAGGCCCGTATGGTACTCTCTTCCCTCGGTTTATGTTTTGCCCATCGATATGACTGGGAGCTTCGCAGCATGCTTCCCATTGTCACTTGTGCAGTCGCTGCTTGCTGCCCCCCGGTGGCTCTGGTCGACATACGTCCTATAGCAGGTTGATGTTGTAATAGCTGCTGTGAAGAAAGTCGGTCGCCGTCACACATGTTGTGTTTACAACTGAGATCACAGATAAGGCCTTTCATTCTGAACTGCTGCTTTTC


Protein sequences

Name Description Sequence
Fpr.2643 translated coding region predicted by ESTScan from UniGene Fpr.2643

XVAVWHKLSHPNVTRFVGASMGTTDLKVPANDHGARANLPARACCVVVEYLAGGTLNQYLINNRRRTLAYXVVVQLALDLTRGLSYLHSRKIVHRDVKTENMLLDTHRNLKIANFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLTFADVSSAVVHQNLRPDVPRCCPNPFANIMRKCWDGNPDKRPNMDEVVQLMEALDTSKGGGMIPDGQSSDAYVSPGHEARMVLSSLGLCFAHRYDWELRSMLPIVTCAVAACCPPVALVDIRPIAG

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-228 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XVAVWHKLSHPNVTRFVGASMGTTDLKVPANDHGARANLPARACCVVVEYLAGGTLNQYLINNRRRTLAYXVVVQLALDLTRGLSYLHSRKIVHRDVKTENMLLDTHRNLKIANFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLTFADVSSAVVHQNLRPDVPRCCPNPFANIMRKCWDGNPDKRPNMDEVVQLMEAL

HMMPanther: PTHR23257:SF276
2-242 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VAVWHKLSHPNVTRFVGASMGTTDLKVPANDHGARANLPARACCVVVEYLAGGTLNQYLINNRRRTLAYXVVVQLALDLTRGLSYLHSRKIVHRDVKTENMLLDTHRNLKIANFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLTFADVSSAVVHQNLRPDVPRCCPNPFANIMRKCWDGNPDKRPNMDEVVQLMEALDTSKGGGMIPDGQS

superfamily: SSF56112
IPR011009
2-229 Protein kinase-like (PK-like)
Protein kinase-like domain

VAVWHKLSHPNVTRFVGASMGTTDLKVPANDHGARANLPARACCVVVEYLAGGTLNQYLINNRRRTLAYXVVVQLALDLTRGLSYLHSRKIVHRDVKTENMLLDTHRNLKIANFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLTFADVSSAVVHQNLRPDVPRCCPNPFANIMRKCWDGNPDKRPNMDEVVQLMEALD

HMMSmart: SM00220
IPR002290
2-228 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

VAVWHKLSHPNVTRFVGASMGTTDLKVPANDHGARANLPARACCVVVEYLAGGTLNQYLINNRRRTLAYXVVVQLALDLTRGLSYLHSRKIVHRDVKTENMLLDTHRNLKIANFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLTFADVSSAVVHQNLRPDVPRCCPNPFANIMRKCWDGNPDKRPNMDEVVQLMEAL

HMMPanther: PTHR23257
2-242 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

VAVWHKLSHPNVTRFVGASMGTTDLKVPANDHGARANLPARACCVVVEYLAGGTLNQYLINNRRRTLAYXVVVQLALDLTRGLSYLHSRKIVHRDVKTENMLLDTHRNLKIANFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLTFADVSSAVVHQNLRPDVPRCCPNPFANIMRKCWDGNPDKRPNMDEVVQLMEALDTSKGGGMIPDGQS

Gene3D: G3DSA:3.30.200.20
3-81 no description

AVWHKLSHPNVTRFVGASMGTTDLKVPANDHGARANLPARACCVVVEYLAGGTLNQYLINNRRRTLAYXVVVQLALDLT

HMMPfam: PF07714
IPR001245
4-224 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

VWHKLSHPNVTRFVGASMGTTDLKVPANDHGARANLPARACCVVVEYLAGGTLNQYLINNRRRTLAYXVVVQLALDLTRGLSYLHSRKIVHRDVKTENMLLDTHRNLKIANFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLTFADVSSAVVHQNLRPDVPRCCPNPFANIMRKCWDGNPDKRPNMDEVVQL

HMMSmart: SM00219
IPR020635
6-225 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

HKLSHPNVTRFVGASMGTTDLKVPANDHGARANLPARACCVVVEYLAGGTLNQYLINNRRRTLAYXVVVQLALDLTRGLSYLHSRKIVHRDVKTENMLLDTHRNLKIANFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLTFADVSSAVVHQNLRPDVPRCCPNPFANIMRKCWDGNPDKRPNMDEVVQLM

FPrintScan: PR00109
IPR001245
48-61 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

VEYLAGGTLNQYLI

Gene3D: G3DSA:1.10.510.10
82-224 no description

RGLSYLHSRKIVHRDVKTENMLLDTHRNLKIANFGVARVEAQNPKDMTGATGTLGYMAPEVLDGKPYNRKCDVYSFGICLWEIYCCDMPYPNLTFADVSSAVVHQNLRPDVPRCCPNPFANIMRKCWDGNPDKRPNMDEVVQL

FPrintScan: PR00109
IPR001245
86-104 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

YLHSRKIVHRDVKTENMLL

PatternScan: PS00108
IPR008271
92-104 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDVKTENMLL

FPrintScan: PR00109
IPR001245
152-174 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

CDVYSFGICLWEIYCCDMPYPNL

FPrintScan: PR00109
IPR001245
196-218 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

CPNPFANIMRKCWDGNPDKRPNM

Seg: seg
277-291 seg

PIVTCAVAACCPPVA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox