PRGDB00193968 (Fpr.2657)

From PRG Wiki
Jump to: navigation, search
Fpr.2657
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237578572 (GO850287)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Festuca pratensis

Comment?

CLS_CLiFpEfSpn_17a7_1_h15cLibkit3LD_D08 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 17h15 3', mRNA sequence

DNA Sequence

GCGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTTTTTAGTTTAGATTGTTTACTTGGATTGTGCCAGCAAAGGCTAAATAAATTTGGGCACCAAAACTGAAGCCACAAGTGTAGCAAAAGTATATATGTCGATGACCAATGGACCATACAAATAAAAAGTGTGGCAAGCCATGTCAGGCTATGACAGAAAACCAACTAAACTCTAAACATCTAGTATTACTCAATAAAAATATTTTCATTTGGTAATATTGATGCATGCAAACGATACACATCTTTGCTTTTTGTGTGCACTAACTTAAATGTGTGTTGCTGCGAAGCCCTAAAGATGGTTAGGATTTGTAAATCTTGGACCTTACATAGACGCTATGCAATATGTGCCAATTATACACCAACTCACTTATTTAATTGTTATTAAAGCAAGACAAGTGCTTCCTCAATTTCCTCTCAAATATGAGTCTCTGATGCCATGTAGCTTGGCGGACACCTCCTGCATGTTGATGCGTTCACCCGGCGATGTCTTGGTGCACGAGAGGCCAATGTTTATCATAGATAACAGAGAGCGTAGACCTTTTTCCTTCGATGCTGTTGGAGTTTCTTGGCAAAGCTCAATCTCTTGTATCAGCTGAGGATCGACAATCTCCATTACCCTATCAGGGAAGCTGATCTCTGTAAACTTTACAATGTTCAGTCCATCCATAAACATGTCATCAGTTGGCCTTCTCCTAAGGAATATCTCGAGGAGGATGACACCAAAGCTGTAAACATCCGCAGCTGTTGAAACTGGACCACCCCCAGCATATTCTGGGAGCAGCGTATCCGATCGTTCCCATTAGTCCAGCTGAAGAAGAGTTTGGGGTTACCAAGAGATGACGTTGTGGAACAACTTTGAATCTTGGGAGGGCCAAAGTCTCCACATGAGCAGTCATATTGTCATCCAAAGAATGTTGCTAGGCTTCAGATCACAATGAACCATTGTTCCTTGGTTGTTATGGTGTAGGTACTCCATTGC


Protein sequences

Name Description Sequence
Fpr.2657 translated coding region predicted by ESTScan from UniGene Fpr.2657

AMEYLHHNNQGTMVHCDLKPSNXSLDDNMTAHVETLALPRFKVVPQRHLLVTPNSSSAGLMGTIGYAAPEYAGGGPVSTAADVYSFGVILLEIFLRRRPTDDMFMDGLNIVKFTEISFPDRVMEIVDPQLIQEIELCQETPTASKEKGLRSLLSMINIGLSCTKTSPGERINMQEVSAKLHGIRDSYLRGN

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-188 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

AMEYLHHNNQGTMVHCDLKPSNXSLDDNMTAHVETLALPRFKVVPQRHLLVTPNSSSAGLMGTIGYAAPEYAGGGPVSTAADVYSFGVILLEIFLRRRPTDDMFMDGLNIVKFTEISFPDRVMEIVDPQLIQEIELCQETPTASKEKGLRSLLSMINIGLSCTKTSPGERINMQEVSAKLHGIRDSYL

HMMPanther: PTHR24420:SF474
1-187 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

AMEYLHHNNQGTMVHCDLKPSNXSLDDNMTAHVETLALPRFKVVPQRHLLVTPNSSSAGLMGTIGYAAPEYAGGGPVSTAADVYSFGVILLEIFLRRRPTDDMFMDGLNIVKFTEISFPDRVMEIVDPQLIQEIELCQETPTASKEKGLRSLLSMINIGLSCTKTSPGERINMQEVSAKLHGIRDSY

superfamily: SSF56112
IPR011009
1-180 Protein kinase-like (PK-like)
Protein kinase-like domain

AMEYLHHNNQGTMVHCDLKPSNXSLDDNMTAHVETLALPRFKVVPQRHLLVTPNSSSAGLMGTIGYAAPEYAGGGPVSTAADVYSFGVILLEIFLRRRPTDDMFMDGLNIVKFTEISFPDRVMEIVDPQLIQEIELCQETPTASKEKGLRSLLSMINIGLSCTKTSPGERINMQEVSAKL

HMMPfam: PF00069
IPR000719
1-176 Pkinase,Ser-thr
Protein kinase, catalytic domain

AMEYLHHNNQGTMVHCDLKPSNXSLDDNMTAHVETLALPRFKVVPQRHLLVTPNSSSAGLMGTIGYAAPEYAGGGPVSTAADVYSFGVILLEIFLRRRPTDDMFMDGLNIVKFTEISFPDRVMEIVDPQLIQEIELCQETPTASKEKGLRSLLSMINIGLSCTKTSPGERINMQEV

HMMPanther: PTHR24420
1-187 FAMILY NOT NAMED,FAMILY NOT NAMED

AMEYLHHNNQGTMVHCDLKPSNXSLDDNMTAHVETLALPRFKVVPQRHLLVTPNSSSAGLMGTIGYAAPEYAGGGPVSTAADVYSFGVILLEIFLRRRPTDDMFMDGLNIVKFTEISFPDRVMEIVDPQLIQEIELCQETPTASKEKGLRSLLSMINIGLSCTKTSPGERINMQEVSAKLHGIRDSY

Gene3D: G3DSA:1.10.510.10
1-180 no description

AMEYLHHNNQGTMVHCDLKPSNXSLDDNMTAHVETLALPRFKVVPQRHLLVTPNSSSAGLMGTIGYAAPEYAGGGPVSTAADVYSFGVILLEIFLRRRPTDDMFMDGLNIVKFTEISFPDRVMEIVDPQLIQEIELCQETPTASKEKGLRSLLSMINIGLSCTKTSPGERINMQEVSAKL

Seg: seg
65-76 seg

GYAAPEYAGGGP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox