PRGDB00193969 (Fpr.2779)

From PRG Wiki
Jump to: navigation, search
Fpr.2779
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237598012 (GO865958)
Gene Class NL
Domain Type NBS, LRR
Gene Species Festuca pratensis

Comment?

CLS_CLiFpEfSpn_52a1_1_g03cLibkit5LD_D02 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 52g03 5', mRNA sequence

DNA Sequence

ATGATGATCTATGGAGTATTCAAACTTGGGGGACAATCAAATGCTGTTTTCCAGAGAACAATCTTGGAAGTCGGATTATCACTACAACAAGAATTGAAGCTGTTGCAAAGGACGGTGACCATGTTTACAGGACACATCCTCTTGAGGAAGCTGATGCCGAAACTTTGTTTTCCCGAATAACTTTTGGGAGTGTCGGTGGGTGTCCTCCCCATTTGAAGGATGTTTCAGCTCAGATCTTGAGAAAGTGTGGTGGTTTGCCACTTGCTATAGTGAGTGTGGGTGCCATGTTAGCCAACAAGACACATACGAAAGATGAATTTGGGCGGTCTGGATTGGAATGGCAAGCAAATTCACAGCTAGAAGTGATGAAACAGGTCATCAAACTTAGCTACAGTGATCTTCCTGCTCATCTCAAAGCATGTCTATTGTACCTTAGCATATTTCCTGAGAACCATGAGATCGAAATAACACGTCTTGTGAGACGTTGGATAGCAGAAGGATTCATCAGTGAACATCATGGCACAAGCACAGAGGAAATAGCAAGGAACTACATCAATGACCTCATTGGTAGAAACTTAATCCAGCCAACACAGCTGAATCATGATGTCACCCCTAGGAGTTGCGCTCTTCATCCGGTAATACATGAGTTCATCGTTTGCAAGGCCATGGAAGATAACTTTGTTGCCTTGGTACATGCTGAGCAGCAAGATGTCCCACCTGGCAACGGCACTGTCCGACGCCTATCCTTGCTGAATAGTGGTAAATCTGATCAGGCTGCGGCACAAATTGATGGGACAAAAGTATCTCGTGCTCGCTCGATCACCGTATTTGCTCACACCGGTGGCACACCTCGTCTAAATGAACTTAGTGTACTACGAGTTCTGGACCTAGGAGGCTGTGAAGGTCCACTTTGCCTTGATGGTCTCTGCAAATTGCTGCTTCTAACGTACTTGACC


Protein sequences

Name Description Sequence
Fpr.2779 translated coding region predicted by ESTScan from UniGene Fpr.2779

XDDLWSIQTWGTIKCCFPENNLGSRIITTTRIEAVAKDGDHVYRTHPLEEADAETLFSRITFGSVGGCPPHLKDVSAQILRKCGGLPLAIVSVGAMLANKTHTKDEFGRSGLEWQANSQLEVMKQVIKLSYSDLPAHLKACLLYLSIFPENHEIEITRLVRRWIAEGFISEHHGTSTEEIARNYINDLIGRNLIQPTQLNHDVTPRSCALHPVIHEFIVCKAMEDNFVALVHAEQQDVPPGNGTVRRLSLLNSGKSDQAAAQIDGTKVSRARSITVFAHTGGTPRLNELSVLRVLDLGGCEGPLCLDGLCKLLLLTYLT


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
2-120 P-loop containing nucleoside triphosphate hydrolases

DDLWSIQTWGTIKCCFPENNLGSRIITTTRIEAVAKDGDHVYRTHPLEEADAETLFSRITFGSVGGCPPHLKDVSAQILRKCGGLPLAIVSVGAMLANKTHTKDEFGRSGLEWQANSQL

HMMPfam: PF00931
IPR002182
2-173 NB-ARC,NBS
NB-ARC

DDLWSIQTWGTIKCCFPENNLGSRIITTTRIEAVAKDGDHVYRTHPLEEADAETLFSRITFGSVGGCPPHLKDVSAQILRKCGGLPLAIVSVGAMLANKTHTKDEFGRSGLEWQANSQLEVMKQVIKLSYSDLPAHLKACLLYLSIFPENHEIEITRLVRRWIAEGFISEHH

HMMPanther: PTHR11017:SF126
2-297 OS11G0237600 PROTEIN,OS11G0237600 PROTEIN

DDLWSIQTWGTIKCCFPENNLGSRIITTTRIEAVAKDGDHVYRTHPLEEADAETLFSRITFGSVGGCPPHLKDVSAQILRKCGGLPLAIVSVGAMLANKTHTKDEFGRSGLEWQANSQLEVMKQVIKLSYSDLPAHLKACLLYLSIFPENHEIEITRLVRRWIAEGFISEHHGTSTEEIARNYINDLIGRNLIQPTQLNHDVTPRSCALHPVIHEFIVCKAMEDNFVALVHAEQQDVPPGNGTVRRLSLLNSGKSDQAAAQIDGTKVSRARSITVFAHTGGTPRLNELSVLRVLDL

HMMPanther: PTHR11017
2-297 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DDLWSIQTWGTIKCCFPENNLGSRIITTTRIEAVAKDGDHVYRTHPLEEADAETLFSRITFGSVGGCPPHLKDVSAQILRKCGGLPLAIVSVGAMLANKTHTKDEFGRSGLEWQANSQLEVMKQVIKLSYSDLPAHLKACLLYLSIFPENHEIEITRLVRRWIAEGFISEHHGTSTEEIARNYINDLIGRNLIQPTQLNHDVTPRSCALHPVIHEFIVCKAMEDNFVALVHAEQQDVPPGNGTVRRLSLLNSGKSDQAAAQIDGTKVSRARSITVFAHTGGTPRLNELSVLRVLDL

Seg: seg
304-318 seg

LCLDGLCKLLLLTYL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox