PRGDB00193970 (Fpr.2937)

From PRG Wiki
Jump to: navigation, search
Fpr.2937
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237569627 (GO839881)
Gene Class N
Domain Type Ser-Thr Kinase, NBS
Gene Species Festuca pratensis

Comment?

CLS_CLiFpEfSpn_108a3_1_d07cLibkit5LD_B04 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 108d07 5', mRNA sequence

DNA Sequence

TCAGAGAAGAGGGCAGATTCTTTCAGTTTTGGTAACAGCAATGCACTGTGAGTTTTCACCATCTGAACTGGAGTGTGCAACACAGAATTTCAGTAGTTTACGGAAGATTGGAGAAGGTGGGTTTGGCTGTGTATACCAAGGTGTCCTCCGAAACATGACAGTTGCAATAAAGGTGCTGAGACGTGATGGTTTGCAAGGACAATCACAGTTCGAACAAGAGGTTACCATCCTTAGTAGAGTGAGACACCCCAACCTGGTAACTCTGCTAGGAGCTTGCTCAGAGTTATCTACACTTGTCTACGAGTTCTTGCCAAATGGTAGCCTTGAAGATTTTCTTGTATGTGAGGACAAGAGAGCAACTCTGACGTGGCAGATGCGCATCCGAATTATTGCCGAGATATGTTCAGCTCTGATCTTTCTGCGTGAGAATAAACCTCACCCAGTTGTTCATGCAGATCTCAAGCCTTCCAACATTCTCCTTGATGCCAACTTAGTCAGTAAGCTTAGTGACTTTGGTATTTCTCGTCTGCTAATCCAGTCCAGTAACGACAACACCACCATGTACCGCACCATGCATCCTTTGGGAACCCCTGCGTACATGGACCCTGAATTTCTTGCCACTGGGGAGATGACACCTCGCTCCGACGTTTATTCTTTTGGGATCATAGTATTGCGTCTCTTAACTGGAAAGCCTCCTGTTGGTGTAAAAAGGATTGTGGAAGATGCCATGATGCAAGGTAACTTGAGCTCTGTAATTGATACCTCAGCCGGGGAATGGCCCGATATGCACGTGCAGCAGTTAGCACACATGGCTCTTGGATGCACTGAGCCAAGCAGGAGGTGCCGTCCTGATCTTTCACGCGAGCTGTGGAGAGCGCTTGATTCCATGAGAGATGATGCAACGTCATCTCCACCTTCATCTTCAAGATCATTGCTGGATGAAAGCAACATACCATCGTACTTCATCTGTCCTATATCTCAGATGTCATGAATGATCCTCACATTGCAGCGGACGGTTTCACCTATGAAGGCGATTTGATCCGGAGCTGGCTCAGTACCGGCAGCGACCCAT


Protein sequences

Name Description Sequence
Fpr.2937 translated coding region predicted by ESTScan from UniGene Fpr.2937

XQRRGQILSVLVTAMHCEFSPSELECATQNFSSLRKIGEGGFGCVYQGVLRNMTVAIKVLRRDGLQGQSQFEQEVTILSRVRHPNLVTLLGACSELSTLVYEFLPNGSLEDFLVCEDKRATLTWQMRIRIIAEICSALIFLRENKPHPVVHADLKPSNILLDANLVSKLSDFGISRLLIQSSNDNTTMYRTMHPLGTPAYMDPEFLATGEMTPRSDVYSFGIIVLRLLTGKPPVGVKRIVEDAMMQGNLSSVIDTSAGEWPDMHVQQLAHMALGCTEPSRRCRPDLSRELWRALDSMRDDATSSPPSSSRSLLDESNIPSYFICPXISDVMNDPHIAADGFTYEGDLIRSWLSTGSDPX

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF448
2-357 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

QRRGQILSVLVTAMHCEFSPSELECATQNFSSLRKIGEGGFGCVYQGVLRNMTVAIKVLRRDGLQGQSQFEQEVTILSRVRHPNLVTLLGACSELSTLVYEFLPNGSLEDFLVCEDKRATLTWQMRIRIIAEICSALIFLRENKPHPVVHADLKPSNILLDANLVSKLSDFGISRLLIQSSNDNTTMYRTMHPLGTPAYMDPEFLATGEMTPRSDVYSFGIIVLRLLTGKPPVGVKRIVEDAMMQGNLSSVIDTSAGEWPDMHVQQLAHMALGCTEPSRRCRPDLSRELWRALDSMRDDATSSPPSSSRSLLDESNIPSYFICPXISDVMNDPHIAADGFTYEGDLIRSWLSTGSD

HMMPanther: PTHR24420
2-357 FAMILY NOT NAMED,FAMILY NOT NAMED

QRRGQILSVLVTAMHCEFSPSELECATQNFSSLRKIGEGGFGCVYQGVLRNMTVAIKVLRRDGLQGQSQFEQEVTILSRVRHPNLVTLLGACSELSTLVYEFLPNGSLEDFLVCEDKRATLTWQMRIRIIAEICSALIFLRENKPHPVVHADLKPSNILLDANLVSKLSDFGISRLLIQSSNDNTTMYRTMHPLGTPAYMDPEFLATGEMTPRSDVYSFGIIVLRLLTGKPPVGVKRIVEDAMMQGNLSSVIDTSAGEWPDMHVQQLAHMALGCTEPSRRCRPDLSRELWRALDSMRDDATSSPPSSSRSLLDESNIPSYFICPXISDVMNDPHIAADGFTYEGDLIRSWLSTGSD

superfamily: SSF56112
IPR011009
3-316 Protein kinase-like (PK-like)
Protein kinase-like domain

RRGQILSVLVTAMHCEFSPSELECATQNFSSLRKIGEGGFGCVYQGVLRNMTVAIKVLRRDGLQGQSQFEQEVTILSRVRHPNLVTLLGACSELSTLVYEFLPNGSLEDFLVCEDKRATLTWQMRIRIIAEICSALIFLRENKPHPVVHADLKPSNILLDANLVSKLSDFGISRLLIQSSNDNTTMYRTMHPLGTPAYMDPEFLATGEMTPRSDVYSFGIIVLRLLTGKPPVGVKRIVEDAMMQGNLSSVIDTSAGEWPDMHVQQLAHMALGCTEPSRRCRPDLSRELWRALDSMRDDATSSPPSSSRSLLDES

Gene3D: G3DSA:3.30.200.20
18-90 no description

EFSPSELECATQNFSSLRKIGEGGFGCVYQGVLRNMTVAIKVLRRDGLQGQSQFEQEVTILSRVRHPNLVTLL

HMMSmart: SM00220
IPR002290
31-302 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSSLRKIGEGGFGCVYQGVLRNMTVAIKVLRRDGLQGQSQFEQEVTILSRVRHPNLVTLLGACSELSTLVYEFLPNGSLEDFLVCEDKRATLTWQMRIRIIAEICSALIFLRENKPHPVVHADLKPSNILLDANLVSKLSDFGISRLLIQSSNDNTTMYRTMHPLGTPAYMDPEFLATGEMTPRSDVYSFGIIVLRLLTGKPPVGVKRIVEDAMMQGNLSSVIDTSAGEWPDMHVQQLAHMALGCTEPSRRCRPDLSRELWRALDSMRDDAT

ProfileScan: PS50011
IPR000719
31-322 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSLRKIGEGGFGCVYQGVLRNMTVAIKVLRRDGLQGQSQFEQEVTILSRVRHPNLVTLLGACSELSTLVYEFLPNGSLEDFLVCEDKRATLTWQMRIRIIAEICSALIFLRENKPHPVVHADLKPSNILLDANLVSKLSDFGISRLLIQSSNDNTTMYRTMHPLGTPAYMDPEFLATGEMTPRSDVYSFGIIVLRLLTGKPPVGVKRIVEDAMMQGNLSSVIDTSAGEWPDMHVQQLAHMALGCTEPSRRCRPDLSRELWRALDSMRDDATSSPPSSSRSLLDESNIPSYF

HMMSmart: SM00219
IPR020635
31-290 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSSLRKIGEGGFGCVYQGVLRNMTVAIKVLRRDGLQGQSQFEQEVTILSRVRHPNLVTLLGACSELSTLVYEFLPNGSLEDFLVCEDKRATLTWQMRIRIIAEICSALIFLRENKPHPVVHADLKPSNILLDANLVSKLSDFGISRLLIQSSNDNTTMYRTMHPLGTPAYMDPEFLATGEMTPRSDVYSFGIIVLRLLTGKPPVGVKRIVEDAMMQGNLSSVIDTSAGEWPDMHVQQLAHMALGCTEPSRRCRPDLSREL

HMMPfam: PF00069
IPR000719
32-285 Pkinase,Ser-thr
Protein kinase, catalytic domain

SSLRKIGEGGFGCVYQGVLRNMTVAIKVLRRDGLQGQSQFEQEVTILSRVRHPNLVTLLGACSELSTLVYEFLPNGSLEDFLVCEDKRATLTWQMRIRIIAEICSALIFLRENKPHPVVHADLKPSNILLDANLVSKLSDFGISRLLIQSSNDNTTMYRTMHPLGTPAYMDPEFLATGEMTPRSDVYSFGIIVLRLLTGKPPVGVKRIVEDAMMQGNLSSVIDTSAGEWPDMHVQQLAHMALGCTEPSRRCRPD

PatternScan: PS00107
IPR017441
37-58 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGFGCVYQGVLRNMTVAIK

Gene3D: G3DSA:1.10.510.10
91-291 no description

GACSELSTLVYEFLPNGSLEDFLVCEDKRATLTWQMRIRIIAEICSALIFLRENKPHPVVHADLKPSNILLDANLVSKLSDFGISRLLIQSSNDNTTMYRTMHPLGTPAYMDPEFLATGEMTPRSDVYSFGIIVLRLLTGKPPVGVKRIVEDAMMQGNLSSVIDTSAGEWPDMHVQQLAHMALGCTEPSRRCRPDLSRELW

PatternScan: PS00108
IPR008271
149-161 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHADLKPSNILL

Seg: seg
303-311 seg

SSPPSSSRS

superfamily: SSF57850
317-356 RING/U-box,NBS

NIPSYFICPXISDVMNDPHIAADGFTYEGDLIRSWLSTGS

HMMPfam: PF04564
IPR003613
318-358 U-box
U box domain

IPSYFICPXISDVMNDPHIAADGFTYEGDLIRSWLSTGSDP

Gene3D: G3DSA:3.30.40.10
IPR013083
319-358 no description
Zinc finger, RING/FYVE/PHD-type

PSYFICPXISDVMNDPHIAADGFTYEGDLIRSWLSTGSDP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox