PRGDB00193971 (Fpr.8238)

From PRG Wiki
Jump to: navigation, search
Fpr.8238
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237602511 (GO879025)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Festuca pratensis

Comment?

CLS_CLiFpEfSpn_79a4_1_j20cLibkit5LD_E10 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 79j20 5', mRNA sequence

DNA Sequence

AGGTGACAAGAAGCAAGGTCGGCAAACAGGTGTGCTTGTCGGGTTGGTTGTTGGCTCAGTAGCTGCTGCTTCATGTGTACTTTTCGTGTTGGTATTCTGCCTTCACAGTGCCCATAAAAGAAAGGATGGCGGTACCAGCGAACCAAAAGACTTTGTAGGTGCTCTTGCAGTAAACACAGACAGAGATTTTAATAATAACAGCCAACAGAACACTCCTGTAGCTTCAGTTCTCCCGCGGTCTACTGGGACTCCTGAGAGGGTATATGGTATAAATGGTTCTCCAGCAAAAAAGATCAAGGTTCCTGGCGCGGCCACTTCTTATACTGTTGCTTCTCTCCAAGTTGCTACAAACAGTTTCTGTCAAGATTCCCTCCTAGGCGAGGGTTCACTTGGTCGTGTTTACAAGGCTGATTTCCCCAATGGACAGGTACTTGCTGTGAAGAAGATAGACAGTGCTTCACTTTCCTTGTATGAAGAAGATCATTTTCTTGAGGTTGTGTCGAGCATTACTCGGCTTAGACACCCAAACATTGTATCGCTTACGGGTTATTGTGTTGAACATGGGCAAAGGCTTCTTGTGTATGAACGCATCACAAATGGAACACTGCATGATATGTTGCACTTTTCTGATGAAGAGAGCAAGACCCTTACATGGAACGCCCGCGTGAGGATAGTGCTAGGCATTGCTCGAGCTTTAGAGTACCTGCATGAGGTGTGCCTGCCCCCTGTTGTACATAGAAATCTTAAGTCATCAAATATCCTGCTTGATGAAGAGTACAGCCCACATCTGTCTGACTGTGGGCTTGCTGCCTTTTCACCAAATCCTGAGAGAGAGGTTTCAACTGAGGTGGTTGGCTCACTTGGATATAGTGCCCCAGAGTTTGCCATGTCAGGAACATATAGCGTAAAGAGTGACGTGTACAGTTTCGGAGTAGTGATGTTAGAGCTACTGACAGGCCGTAAACCGCTAGATAGATCACGAGAGAGGCCGGAGCAGTCCCTTGTCGGATGGGCAACCCCGCAGCTTCACGACATGATGCGCTCGGCAGATGGTTGATCCATCAATGGATGG


Protein sequences

Name Description Sequence
Fpr.8238 translated coding region predicted by ESTScan from UniGene Fpr.8238

XGDKKQGRQTGVLVGLVVGSVAAASCVLFVLVFCLHSAHKRKDGGTSEPKDFVGALAVNTDRDFNNNSQQNTPVASVLPRSTGTPERVYGINGSPAKKIKVPGAATSYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGQVLAVKKIDSASLSLYEEDHFLEVVSSITRLRHPNIVSLTGYCVEHGQRLLVYERITNGTLHDMLHFSDEESKTLTWNARVRIVLGIARALEYLHEVCLPPVVHRNLKSSNILLDEEYSPHLSDCGLAAFSPNPEREVSTEVVGSLGYSAPEFAMSGTYSVKSDVYSFGVVMLELLTGRKPLDRSRERPEQSLVGWATPQLHDMMRSADGXSINGW

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF887
3-345 OS06G0634500 PROTEIN (FRAGMENT)

DKKQGRQTGVLVGLVVGSVAAASCVLFVLVFCLHSAHKRKDGGTSEPKDFVGALAVNTDRDFNNNSQQNTPVASVLPRSTGTPERVYGINGSPAKKIKVPGAATSYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGQVLAVKKIDSASLSLYEEDHFLEVVSSITRLRHPNIVSLTGYCVEHGQRLLVYERITNGTLHDMLHFSDEESKTLTWNARVRIVLGIARALEYLHEVCLPPVVHRNLKSSNILLDEEYSPHLSDCGLAAFSPNPEREVSTEVVGSLGYSAPEFAMSGTYSVKSDVYSFGVVMLELLTGRKPLDRSRERPEQSLVGWATPQLHD

HMMPanther: PTHR24420
3-345 FAMILY NOT NAMED,FAMILY NOT NAMED

DKKQGRQTGVLVGLVVGSVAAASCVLFVLVFCLHSAHKRKDGGTSEPKDFVGALAVNTDRDFNNNSQQNTPVASVLPRSTGTPERVYGINGSPAKKIKVPGAATSYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGQVLAVKKIDSASLSLYEEDHFLEVVSSITRLRHPNIVSLTGYCVEHGQRLLVYERITNGTLHDMLHFSDEESKTLTWNARVRIVLGIARALEYLHEVCLPPVVHRNLKSSNILLDEEYSPHLSDCGLAAFSPNPEREVSTEVVGSLGYSAPEFAMSGTYSVKSDVYSFGVVMLELLTGRKPLDRSRERPEQSLVGWATPQLHD

Seg: seg
11-28 seg

GVLVGLVVGSVAAASCVL

superfamily: SSF56112
IPR011009
92-325 Protein kinase-like (PK-like)
Protein kinase-like domain

NGSPAKKIKVPGAATSYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGQVLAVKKIDSASLSLYEEDHFLEVVSSITRLRHPNIVSLTGYCVEHGQRLLVYERITNGTLHDMLHFSDEESKTLTWNARVRIVLGIARALEYLHEVCLPPVVHRNLKSSNILLDEEYSPHLSDCGLAAFSPNPEREVSTEVVGSLGYSAPEFAMSGTYSVKSDVYSFGVVMLELLTGRKPLD

Gene3D: G3DSA:3.30.200.20
103-183 no description

GAATSYTVASLQVATNSFCQDSLLGEGSLGRVYKADFPNGQVLAVKKIDSASLSLYEEDHFLEVVSSITRLRHPNIVSLTG

ProfileScan: PS50011
IPR000719
120-358 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FCQDSLLGEGSLGRVYKADFPNGQVLAVKKIDSASLSLYEEDHFLEVVSSITRLRHPNIVSLTGYCVEHGQRLLVYERITNGTLHDMLHFSDEESKTLTWNARVRIVLGIARALEYLHEVCLPPVVHRNLKSSNILLDEEYSPHLSDCGLAAFSPNPEREVSTEVVGSLGYSAPEFAMSGTYSVKSDVYSFGVVMLELLTGRKPLDRSRERPEQSLVGWATPQLHDMMRSADGXSINGW

HMMSmart: SM00220
IPR002290
120-355 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FCQDSLLGEGSLGRVYKADFPNGQVLAVKKIDSASLSLYEEDHFLEVVSSITRLRHPNIVSLTGYCVEHGQRLLVYERITNGTLHDMLHFSDEESKTLTWNARVRIVLGIARALEYLHEVCLPPVVHRNLKSSNILLDEEYSPHLSDCGLAAFSPNPEREVSTEVVGSLGYSAPEFAMSGTYSVKSDVYSFGVVMLELLTGRKPLDRSRERPEQSLVGWATPQLHDMMRSADGXSI

HMMSmart: SM00219
IPR020635
120-347 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FCQDSLLGEGSLGRVYKADFPNGQVLAVKKIDSASLSLYEEDHFLEVVSSITRLRHPNIVSLTGYCVEHGQRLLVYERITNGTLHDMLHFSDEESKTLTWNARVRIVLGIARALEYLHEVCLPPVVHRNLKSSNILLDEEYSPHLSDCGLAAFSPNPEREVSTEVVGSLGYSAPEFAMSGTYSVKSDVYSFGVVMLELLTGRKPLDRSRERPEQSLVGWATPQLHDMM

HMMPfam: PF00069
IPR000719
123-333 Pkinase,Ser-thr
Protein kinase, catalytic domain

DSLLGEGSLGRVYKADFPNGQVLAVKKIDSASLSLYEEDHFLEVVSSITRLRHPNIVSLTGYCVEHGQRLLVYERITNGTLHDMLHFSDEESKTLTWNARVRIVLGIARALEYLHEVCLPPVVHRNLKSSNILLDEEYSPHLSDCGLAAFSPNPEREVSTEVVGSLGYSAPEFAMSGTYSVKSDVYSFGVVMLELLTGRKPLDRSRERPEQ

Gene3D: G3DSA:1.10.510.10
184-328 no description

YCVEHGQRLLVYERITNGTLHDMLHFSDEESKTLTWNARVRIVLGIARALEYLHEVCLPPVVHRNLKSSNILLDEEYSPHLSDCGLAAFSPNPEREVSTEVVGSLGYSAPEFAMSGTYSVKSDVYSFGVVMLELLTGRKPLDRSR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox