PRGDB00193972 (Fpr.11663)

From PRG Wiki
Jump to: navigation, search
Fpr.11663
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237576285 (GO851749)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Festuca pratensis

Comment?

CLS_CLiFpEfSpn_1a4_1_f16cLibkit5LD_C08 CLS_CLiFpEfSPn_plant Festuca pratensis cDNA clone 1f16 5', mRNA sequence

DNA Sequence

AGTGCTACCTGACAGTCAAGAAATAGCCATCAAAAGGCTTGGTCAGACTTCCAGACAAGGAATAGGAGAACTGAAGAGTGAACTGGTTCTAGTTGCCAAGCTTCACCACAGGAATCTTGTGAGACTTGTTGGTGTTTGCTTGGAAGAACATGAGAAAATACTTGTGTATGAATATATGCCCAACAGAAGCCTTGATACCATTATTTTCGATTTTGAGAGAAAGAAAGAGTTGGATTGGGGAAAGAGGTTCAAGATTATCAATGGAATCGCTCGAGGCTTACAATACCTCCATGAAGATTCTCAACTGAAGATAGTTCACCGTGACCTCAAAGCGAGCAACGTACTGCTAGATTTGGATTTCAATCCCAAAATTTCTGATTTCGGCCTAGCAAAGATATTCGGAGGGGATCAATTAGAGGATGTGACTCGTCGTATCGCCGGAACATACGGATACATGGCGCCTGAATACGCCATGCGCGGTCAGTATTCCATCAAGTCGGACGTGTTCAGCTTCGGCGTCTTGGTCTTAGAGATCGTCACCGGCAGAAGAAACAGTGGCTCGTGTAACACTGAGCAAGACGTCGATCTCTTGAATCTTGTATGGGAGCACTGGACTCGGGGAAACGTCATCGAGCTGATCGATCCATCCCTGAGCAACCGTCCTCCCGTCGACCGGATTCTCAAGTGCATCCACCTCGGGCTCCTGTGCGTGCAGAGAAAACCGGCGAGCAGGCCGGCGATGTCGTCGGTGAATATCATGTTCAGCAGCCACACTGTCCGTCTCCCTTCTCTGTCCAGGCCGGCGTTCTGGATCCAGGGAGGTCGGCGTCAATCAAAGCTCAACTGCGTACTCGGAAGCCTATCCGCTCACAGAAAAATCAACTGTGATGTCTTCGAACGAAGTGTCGATCACGGAGCTTTCGCCCAGATGAGTCTTCCAGCTCAAGCTTTGGGAGCACTTTACTGAACAATATTTGTACACTATTTTGAATTTCTGGAAATGATACTGATGTGAAGTAGAATTGCTAAGCTGCAATGCTTAGGGACTGAAACTAGTGGGAACTTCACTTGCATCGAAAAAAAAAAAAAAA


Protein sequences

Name Description Sequence
Fpr.11663 translated coding region predicted by ESTScan from UniGene Fpr.11663

XVLPDSQEIAIKRLGQTSRQGIGELKSELVLVAKLHHRNLVRLVGVCLEEHEKILVYEYMPNRSLDTIIFDFERKKELDWGKRFKIINGIARGLQYLHEDSQLKIVHRDLKASNVLLDLDFNPKISDFGLAKIFGGDQLEDVTRRIAGTYGYMAPEYAMRGQYSIKSDVFSFGVLVLEIVTGRRNSGSCNTEQDVDLLNLVWEHWTRGNVIELIDPSLSNRPPVDRILKCIHLGLLCVQRKPASRPAMSSVNIMFSSHTVRLPSLSRPAFWIQGGRRQSKLNCVLGSLSAHRKINCDVFERSVDHGAFAQMSLPAQALGALY

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-255 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XVLPDSQEIAIKRLGQTSRQGIGELKSELVLVAKLHHRNLVRLVGVCLEEHEKILVYEYMPNRSLDTIIFDFERKKELDWGKRFKIINGIARGLQYLHEDSQLKIVHRDLKASNVLLDLDFNPKISDFGLAKIFGGDQLEDVTRRIAGTYGYMAPEYAMRGQYSIKSDVFSFGVLVLEIVTGRRNSGSCNTEQDVDLLNLVWEHWTRGNVIELIDPSLSNRPPVDRILKCIHLGLLCVQRKPASRPAMSSVNIMF

HMMPanther: PTHR24420
2-322 FAMILY NOT NAMED,FAMILY NOT NAMED

VLPDSQEIAIKRLGQTSRQGIGELKSELVLVAKLHHRNLVRLVGVCLEEHEKILVYEYMPNRSLDTIIFDFERKKELDWGKRFKIINGIARGLQYLHEDSQLKIVHRDLKASNVLLDLDFNPKISDFGLAKIFGGDQLEDVTRRIAGTYGYMAPEYAMRGQYSIKSDVFSFGVLVLEIVTGRRNSGSCNTEQDVDLLNLVWEHWTRGNVIELIDPSLSNRPPVDRILKCIHLGLLCVQRKPASRPAMSSVNIMFSSHTVRLPSLSRPAFWIQGGRRQSKLNCVLGSLSAHRKINCDVFERSVDHGAFAQMSLPAQALGALY

HMMPanther: PTHR24420:SF430
2-322 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VLPDSQEIAIKRLGQTSRQGIGELKSELVLVAKLHHRNLVRLVGVCLEEHEKILVYEYMPNRSLDTIIFDFERKKELDWGKRFKIINGIARGLQYLHEDSQLKIVHRDLKASNVLLDLDFNPKISDFGLAKIFGGDQLEDVTRRIAGTYGYMAPEYAMRGQYSIKSDVFSFGVLVLEIVTGRRNSGSCNTEQDVDLLNLVWEHWTRGNVIELIDPSLSNRPPVDRILKCIHLGLLCVQRKPASRPAMSSVNIMFSSHTVRLPSLSRPAFWIQGGRRQSKLNCVLGSLSAHRKINCDVFERSVDHGAFAQMSLPAQALGALY

HMMSmart: SM00219
IPR020635
2-255 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VLPDSQEIAIKRLGQTSRQGIGELKSELVLVAKLHHRNLVRLVGVCLEEHEKILVYEYMPNRSLDTIIFDFERKKELDWGKRFKIINGIARGLQYLHEDSQLKIVHRDLKASNVLLDLDFNPKISDFGLAKIFGGDQLEDVTRRIAGTYGYMAPEYAMRGQYSIKSDVFSFGVLVLEIVTGRRNSGSCNTEQDVDLLNLVWEHWTRGNVIELIDPSLSNRPPVDRILKCIHLGLLCVQRKPASRPAMSSVNIMF

Gene3D: G3DSA:3.30.200.20
3-60 no description

LPDSQEIAIKRLGQTSRQGIGELKSELVLVAKLHHRNLVRLVGVCLEEHEKILVYEYM

HMMSmart: SM00220
IPR002290
3-231 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LPDSQEIAIKRLGQTSRQGIGELKSELVLVAKLHHRNLVRLVGVCLEEHEKILVYEYMPNRSLDTIIFDFERKKELDWGKRFKIINGIARGLQYLHEDSQLKIVHRDLKASNVLLDLDFNPKISDFGLAKIFGGDQLEDVTRRIAGTYGYMAPEYAMRGQYSIKSDVFSFGVLVLEIVTGRRNSGSCNTEQDVDLLNLVWEHWTRGNVIELIDPSLSNRPPVDRILKCI

superfamily: SSF56112
IPR011009
5-263 Protein kinase-like (PK-like)
Protein kinase-like domain

DSQEIAIKRLGQTSRQGIGELKSELVLVAKLHHRNLVRLVGVCLEEHEKILVYEYMPNRSLDTIIFDFERKKELDWGKRFKIINGIARGLQYLHEDSQLKIVHRDLKASNVLLDLDFNPKISDFGLAKIFGGDQLEDVTRRIAGTYGYMAPEYAMRGQYSIKSDVFSFGVLVLEIVTGRRNSGSCNTEQDVDLLNLVWEHWTRGNVIELIDPSLSNRPPVDRILKCIHLGLLCVQRKPASRPAMSSVNIMFSSHTVRLP

HMMPfam: PF07714
IPR001245
6-252 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SQEIAIKRLGQTSRQGIGELKSELVLVAKLHHRNLVRLVGVCLEEHEKILVYEYMPNRSLDTIIFDFERKKELDWGKRFKIINGIARGLQYLHEDSQLKIVHRDLKASNVLLDLDFNPKISDFGLAKIFGGDQLEDVTRRIAGTYGYMAPEYAMRGQYSIKSDVFSFGVLVLEIVTGRRNSGSCNTEQDVDLLNLVWEHWTRGNVIELIDPSLSNRPPVDRILKCIHLGLLCVQRKPASRPAMSSVN

Gene3D: G3DSA:1.10.510.10
61-251 no description

PNRSLDTIIFDFERKKELDWGKRFKIINGIARGLQYLHEDSQLKIVHRDLKASNVLLDLDFNPKISDFGLAKIFGGDQLEDVTRRIAGTYGYMAPEYAMRGQYSIKSDVFSFGVLVLEIVTGRRNSGSCNTEQDVDLLNLVWEHWTRGNVIELIDPSLSNRPPVDRILKCIHLGLLCVQRKPASRPAMSSV

PatternScan: PS00108
IPR008271
105-117 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKASNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox