PRGDB00194124 (Mes.13251)

From PRG Wiki
Jump to: navigation, search
Mes.13251
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 164378579 (DB953714)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Manihot esculenta

Comment?

DB953714 full-length enriched cassava cDNA library Manihot esculenta cDNA clone CAS01_047_G18 3', mRNA sequence

DNA Sequence

ACTCTAGGGCTGCTGGTGTTGGAAGATGTCCTGAAAATGAAAGCAGGTTGTTTAGGAGAAGGAAGAGTTGTCTCACTACTCAACATTAGAACAACTGCTGACATTGTAGGCCTATCCACTGCACCTTCTTGCACGCACAAGAGTCCTATTTGTATGCATCTCAACACTTCATAAGGATTATATGACTCCTCCAGCGATGAATCAACTATCTCCAATGCTCTGCCTTCTCTCCATAACTCCCAAACATGTCCTATCAAGCTCAAGGACGCATCCTCTTGGTGAAAGCCATTGCTTCTCTTTCCACTTATAATCTCTAATAATATCACCCCAAAACTGAACACATCAGATTTTATTGAAAATTTTCCAAATATAGCATACTCTGGTGACATATAACCATATGTCCCAACAACTCTATTCGTCTTATTTTGAATTTGGTCGCTTTTGAATATTCTTGCCATGCCAAAGTCTGAAATTTTTGGGTTCATCTCAGCATCCAATAAAATGTTACTACTCTTTAAATCTCTATGGATGATTCTTAATCTTGAGTCTTGATGAAGATATAAAATGCCACGAGCAATCCCAATAATAATATTGAAGCGCTTTGTCCAATCCA


Protein sequences

Name Description Sequence
Mes.13251 translated coding region predicted by ESTScan from UniGene Mes.13251

XDWTKRFNIIIGIARGILYLHQDSRLRIIHRDLKSSNILLDAEMNPKISDFGMARIFKSDQIQNKTNRVVGTYGYMSPEYAIFGKFSIKSDVFSFGVILLEIISGKRSNGFHQEDASLSLIGHVWELWREGRALEIVDSSLEESYNPYEVLRCIQIGLLCVQEGAVDRPTMSAVVLMLSSETTLPSPKQPAFIFRTSSNTSSPRV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-192 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XDWTKRFNIIIGIARGILYLHQDSRLRIIHRDLKSSNILLDAEMNPKISDFGMARIFKSDQIQNKTNRVVGTYGYMSPEYAIFGKFSIKSDVFSFGVILLEIISGKRSNGFHQEDASLSLIGHVWELWREGRALEIVDSSLEESYNPYEVLRCIQIGLLCVQEGAVDRPTMSAVVLMLSSETTLPSPKQPAF

HMMSmart: SM00220
IPR002290
1-154 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

XDWTKRFNIIIGIARGILYLHQDSRLRIIHRDLKSSNILLDAEMNPKISDFGMARIFKSDQIQNKTNRVVGTYGYMSPEYAIFGKFSIKSDVFSFGVILLEIISGKRSNGFHQEDASLSLIGHVWELWREGRALEIVDSSLEESYNPYEVLRCI

HMMSmart: SM00219
IPR020635
1-178 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

XDWTKRFNIIIGIARGILYLHQDSRLRIIHRDLKSSNILLDAEMNPKISDFGMARIFKSDQIQNKTNRVVGTYGYMSPEYAIFGKFSIKSDVFSFGVILLEIISGKRSNGFHQEDASLSLIGHVWELWREGRALEIVDSSLEESYNPYEVLRCIQIGLLCVQEGAVDRPTMSAVVLML

Gene3D: G3DSA:1.10.510.10
2-176 no description

DWTKRFNIIIGIARGILYLHQDSRLRIIHRDLKSSNILLDAEMNPKISDFGMARIFKSDQIQNKTNRVVGTYGYMSPEYAIFGKFSIKSDVFSFGVILLEIISGKRSNGFHQEDASLSLIGHVWELWREGRALEIVDSSLEESYNPYEVLRCIQIGLLCVQEGAVDRPTMSAVVL

superfamily: SSF56112
IPR011009
2-178 Protein kinase-like (PK-like)
Protein kinase-like domain

DWTKRFNIIIGIARGILYLHQDSRLRIIHRDLKSSNILLDAEMNPKISDFGMARIFKSDQIQNKTNRVVGTYGYMSPEYAIFGKFSIKSDVFSFGVILLEIISGKRSNGFHQEDASLSLIGHVWELWREGRALEIVDSSLEESYNPYEVLRCIQIGLLCVQEGAVDRPTMSAVVLML

HMMPanther: PTHR24420:SF430
2-205 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

DWTKRFNIIIGIARGILYLHQDSRLRIIHRDLKSSNILLDAEMNPKISDFGMARIFKSDQIQNKTNRVVGTYGYMSPEYAIFGKFSIKSDVFSFGVILLEIISGKRSNGFHQEDASLSLIGHVWELWREGRALEIVDSSLEESYNPYEVLRCIQIGLLCVQEGAVDRPTMSAVVLMLSSETTLPSPKQPAFIFRTSSNTSSPRV

HMMPanther: PTHR24420
2-205 FAMILY NOT NAMED,FAMILY NOT NAMED

DWTKRFNIIIGIARGILYLHQDSRLRIIHRDLKSSNILLDAEMNPKISDFGMARIFKSDQIQNKTNRVVGTYGYMSPEYAIFGKFSIKSDVFSFGVILLEIISGKRSNGFHQEDASLSLIGHVWELWREGRALEIVDSSLEESYNPYEVLRCIQIGLLCVQEGAVDRPTMSAVVLMLSSETTLPSPKQPAFIFRTSSNTSSPRV

HMMPfam: PF00069
IPR000719
5-108 Pkinase,Ser-thr
Protein kinase, catalytic domain

KRFNIIIGIARGILYLHQDSRLRIIHRDLKSSNILLDAEMNPKISDFGMARIFKSDQIQNKTNRVVGTYGYMSPEYAIFGKFSIKSDVFSFGVILLEIISGKRS

PatternScan: PS00108
IPR008271
28-40 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox